KEGG   Prochlorococcus marinus MED4: PMM0961Help
Entry
PMM0961           CDS       T00142                                 

Definition
glycoside hydrolase family protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PMM0961
Enzymes [BR:pmm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     PMM0961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(918353..920110)
Genome map
AA seq 585 aa AA seqDB search
MTQIDSKKKFDRLRLCKLLETIYKEHTTEELNLICNQLLQILDNFSEKSRYEEISEDKKW
DESFAVLITYADGVYKKGETTLVTLRELLSKNFGSLSKVVHILPFLKSTSDGGFAVSSHT
SLEEKFGSWEDLKSISNKHYLMADLVLNHVSSSHPWVQQFIKCQEPGLSNVFSPSQDLDW
KNVIRPRSSSLFSQINTDDGQKQVWTTFGPDQIDLNWLNPKMTIEFLNLIITYLSNGIKW
LRLDAVGFIWKEPGTTCLHLSKAHSIVKILRILLNDLLKDGVLITETNVPQKENLSYLLP
EDEADMAYNFPLPPLLLEAIISSRADILNAWICDWPELPKTTTLFNFTASHDGVGLRALE
GLMNEQRIKDLLINCEKRGGLVSHRRLSNGEDKPYELNISWWSAMEDPGRDSNRYQYERF
LLTQLLVMSLKGVPAFYLPALLASENDIKSFSMTGQRRDLNREKFKSEKLAAVFNNPESN
ANKNLKYLRHAMDVRAKLPQFHPQSHMECLSKNRADIVALKRGIGSKAVFTIHNMTENKI
NYRFIDYEFNKLIKNDLNMQDYLTSNKYNSNNIELDPFQVIWLGF
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaaattgattcaaagaaaaaatttgatagattaaggctttgtaaattgctagaa
acaatttataaggagcatactactgaagagcttaacttaatttgtaatcaattattgcag
attttagataatttctcagagaaatctcgttatgaagaaataagtgaagataaaaagtgg
gatgaatcttttgctgttttaataacctatgccgatggggtttataaaaaaggagaaact
acacttgtaacgcttcgagaattactaagtaaaaattttgggagtttatcaaaagtagtt
catattcttccatttcttaaatcaactagtgatggtggttttgctgtgtcaagtcatacg
tctttagaagaaaaatttggtagttgggaggatttaaaaagtatctctaataaacattat
ttaatggctgatttagttttaaatcatgtttcttcatctcatccatgggttcagcaattt
attaaatgtcaagaacccggattatctaatgtcttttctccttcacaagatcttgactgg
aaaaatgttatcagaccaagaagttcatctttattctcccaaataaatacagacgatgga
caaaaacaagtttggacaacttttggtccagatcaaattgatttgaattggcttaatccc
aaaatgacaatagagtttcttaacttgattattacttatttatcaaatggtattaaatgg
ttaagacttgacgctgtaggttttatttggaaggagcctggtacaacttgtttgcattta
tcaaaagcacattcaatagtaaaaattttaagaatacttttaaatgaccttcttaaggat
ggcgtattaattactgaaactaatgttccacagaaggaaaacctctcttatttattacca
gaagatgaggcggacatggcttataatttccctctgccacctcttcttttagaagcaata
attagttcaagagcagatattttaaatgcatggatttgtgattggccagagttacccaaa
actacaacgctatttaatttcactgcttctcatgatggggtgggattaagggctttagag
ggtctaatgaatgaacaaagaattaaagatttattgattaattgtgagaaaagagggggt
ctagtaagtcatagaaggttatcgaacggagaagataaaccttatgaactaaatattagt
tggtggagcgctatggaagatcctggtagggattcaaatcgttatcaatatgaaaggttt
ttgttaactcaattacttgttatgtcactaaaaggcgttcctgctttttatctaccagca
ttgctagcttcagaaaatgatataaaaagtttttcaatgacaggtcaaagaagagatttg
aatagagaaaaatttaagtcagagaaactagcagctgtttttaataatcctgaatctaac
gctaataaaaatcttaaatacctccgacatgcaatggatgttagagccaaattaccccaa
ttccatcctcaatcgcatatggaatgtttatctaaaaatagagctgatattgttgcatta
aaaagaggtattggttcaaaagctgttttcacaattcataatatgaccgaaaataaaatt
aattacaggtttattgattatgaatttaataaattgattaaaaatgatttaaatatgcag
gattatcttacatctaataaatataattctaataatattgaacttgatccctttcaagtt
atttggcttggtttttga

  All links  
No link information was found.   
DBGET integrated database retrieval system