KEGG   Prochlorococcus marinus MED4: PMM1006Help
Entry
PMM1006           CDS       T00142                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PMM1006
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PMM1006
Enzymes [BR:pmm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PMM1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
956998..957510
Genome map
AA seq 170 aa AA seqDB search
MLSSIDKFLKLMVVDVQNTTVVSANGEAKKLGQYSGNVILIVNVASYCGNTAQYKDLQKL
HDKYSKKGLRILAFPCNDFGNQEPDSLTEIKNFCSTKYGVEFEIMEKVHAKGNTSEPYTT
LNNVEPKGDVEWNFEKFLIGKDSNVIARFKPGIQPFDENLIAAIEVAIDS
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgttatcttcaatagataaatttctcaaacttatggtagtagatgtccaaaacacaacc
gttgtttcagcaaatggagaagcgaaaaaacttggccaatattcaggaaatgtaattttg
atagtaaacgtcgccagttattgcggtaatactgctcaatataaggatctccaaaagctt
cacgataaatattcaaaaaaaggtttaaggattcttgctttcccttgtaatgacttcggg
aatcaagagcctgattctcttacagagataaagaacttttgttctacaaaatatggtgtt
gaattcgaaattatggaaaaagtacacgcgaaaggtaatactagcgaaccatatacaaca
ctaaataatgttgaaccaaagggtgatgttgaatggaattttgaaaaatttttaattggc
aaagatagtaatgtgattgcaaggtttaaacctggtattcaaccattcgatgaaaattta
attgccgcaatagaagtagcaatagattcttaa

DBGET integrated database retrieval system