KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM1006Help
Entry
PMM1006           CDS       T00142                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Pathway
pmm00480  Glutathione metabolism
pmm00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PMM1006
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PMM1006
Enzymes [BR:pmm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PMM1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CAE19465
CYORF: PMM1006
UniProt: Q7V177
Position
956998..957510
Genome map
AA seq 170 aa AA seqDB search
MLSSIDKFLKLMVVDVQNTTVVSANGEAKKLGQYSGNVILIVNVASYCGNTAQYKDLQKL
HDKYSKKGLRILAFPCNDFGNQEPDSLTEIKNFCSTKYGVEFEIMEKVHAKGNTSEPYTT
LNNVEPKGDVEWNFEKFLIGKDSNVIARFKPGIQPFDENLIAAIEVAIDS
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgttatcttcaatagataaatttctcaaacttatggtagtagatgtccaaaacacaacc
gttgtttcagcaaatggagaagcgaaaaaacttggccaatattcaggaaatgtaattttg
atagtaaacgtcgccagttattgcggtaatactgctcaatataaggatctccaaaagctt
cacgataaatattcaaaaaaaggtttaaggattcttgctttcccttgtaatgacttcggg
aatcaagagcctgattctcttacagagataaagaacttttgttctacaaaatatggtgtt
gaattcgaaattatggaaaaagtacacgcgaaaggtaatactagcgaaccatatacaaca
ctaaataatgttgaaccaaagggtgatgttgaatggaattttgaaaaatttttaattggc
aaagatagtaatgtgattgcaaggtttaaacctggtattcaaccattcgatgaaaattta
attgccgcaatagaagtagcaatagattcttaa

DBGET integrated database retrieval system