KEGG   Prochlorococcus marinus MED4: PMM1044Help
Entry
PMM1044           CDS       T00142                                 

Gene name
rbsK
Definition
pfkB family carbohydrate kinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PMM1044 (rbsK)
Enzymes [BR:pmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PMM1044 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(986582..987559)
Genome map
AA seq 325 aa AA seqDB search
MIEKGKDKIVFVYYLLVCLVNSYANDIYPNNSINKLMIEEENYNFQDYKFIKGNLKFAVI
GHIEWINFIEVDQLPQPGLISHSKKSLEYPAGGGSVIAKRLRELTNSEVHFFTALGNDFY
GKQCLNILENMGIKLHVGWRDKPTRKGFSVIDSDGERSITIIGDRLSPNHIDDLDWAILD
EMDGVFITAGDKELFKKSRVAKILCTTPRVGLNIINESEIFLDGLIGSNLDPGEVFSLDE
LKLNPKYVIKTEGENGGIVFPGGRYKAIKTKKNKVDSYGCGDSFAAGILYGLSSDWNIEE
SLNLAKIMGRNCSEHFGPYKKCYQL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaaaaggtaaagataagatagtttttgtttattatcttttagtatgtttagtg
aattcatatgcaaatgatatataccctaataatagtattaataaacttatgattgaagaa
gaaaattataattttcaggattataaatttataaaaggaaacctaaagtttgctgttatt
ggacatatcgagtggataaattttattgaagtagatcaattacctcaaccaggtttaatc
tctcattctaaaaaatctttagaatatcctgccgggggaggatcagtaatagctaaaaga
ctaagggaattaacgaacagtgaagtccatttctttacagctttagggaatgatttttat
ggtaagcaatgtttaaatattcttgaaaatatgggtattaaattacatgtaggatggcga
gataaaccaacaagaaaaggtttcagtgtaattgattctgatggcgaaagatctatcact
attattggagatagattgtctcctaatcatattgatgatttagattgggctatccttgat
gagatggatggagtttttattacggcaggcgataaagaattatttaaaaaatcgagggta
gctaaaatattatgtacgacgcccagagtagggttaaatataattaacgaatccgagata
tttttagatggattaattggaagtaatcttgatcctggagaagttttttctttagatgaa
ttaaaattaaacccaaaatatgttatcaaaacagaaggtgagaatggcgggatagtattc
ccaggaggtagatataaagctattaaaactaaaaaaaataaggttgactcatatggatgc
ggcgattctttcgcggcaggaattctttatggactttcctcagattggaatatagaagaa
agtttaaatcttgctaaaataatgggtagaaattgcagtgaacattttggaccatataaa
aaatgttatcaattatag

DBGET integrated database retrieval system