KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM1055Help
Entry
PMM1055           CDS       T00142                                 

Gene name
chlI
Definition
(GenBank) Protoporphyrin IX Magnesium chelatase, ChlI subunit
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Pathway
pmm00860  Porphyrin and chlorophyll metabolism
pmm01100  Metabolic pathways
pmm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PMM1055 (chlI)
Enzymes [BR:pmm01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PMM1055 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_22 MCM AAA_16 Sigma54_activat AAA_29 AAA_18 AAA DUF815 ABC_tran AAA_30 AAA_14 MMR_HSR1 AAA_28 AAA_7
Motif
Other DBs
NCBI-ProteinID: CAE19514
CYORF: PMM1055
UniProt: Q7TU82
Position
complement(996449..997537)
Genome map
AA seq 362 aa AA seqDB search
MNRTKKRRVFPFTAVIGQEEMKLALLLNVIDPRIGGVMIMGDRGTGKSTTIRALADLLPA
IDVVKDDPYNSSLIDPDLQSKEVLEKIVQGESLEKDKKQVPMVDLPLGATEDRLCGTIDI
EKALSEGIKAFEPGLLAKANRGLLYVDEVNLLDDHLVDVLLDSAASGWNTVEREGVSVRH
PARFVLIGSGNPEEGELRPQLLDRFGMSVEVKTVRDAELRVKVVDQRTSFDDNPDEFSIS
VEKQQDDLQQKVIKAQEILNSVQLDDDLRLNISAICGELDVDGLRGDIVTNRSARAIAAF
EGRTEVQEEDIARVITCSLRHRLRKDPLEQVDSGERVIQAFCKVFDLNEKEDLSKFQLSS
QE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgaatagaacaaagaaaagaagagtttttccttttactgctgtaattggtcaagaagaa
atgaaattagctcttttgttaaatgttatagatccaagaattggaggagtaatgattatg
ggtgacagaggaactggtaaatctacaactataagagctctagcagacttgttaccagct
atagatgttgttaaagatgatccatataatagttcacttatagatcctgatttacagagt
aaagaagttttagagaaaattgtacagggagaaagtttggagaaagataaaaaacaagtc
ccaatggttgatttgccattgggggcaacagaagacagactgtgcggaactattgatata
gaaaaggctttaagcgaaggaattaaggcctttgaaccaggcttattagcaaaagctaat
agaggcttgttatacgtagacgaagttaatctactcgacgatcatttagttgatgttctt
ttagattccgccgcatctggatggaatacagttgagagagagggagtttcagttagacat
cctgcaagatttgttttaattggctctggcaatccagaagagggagaacttaggcctcag
ttattagataggtttggtatgagcgttgaggttaagacagtaagagatgcggaattaagg
gttaaagttgttgatcagcgaacttcatttgatgataatcccgatgaattctcgataagt
gttgagaaacagcaagatgaccttcagcaaaaagttattaaagctcaagagatattaaat
tcagttcaattggatgatgatctaagattaaatatatctgctatatgtggcgaacttgat
gttgatggactaaggggggatattgtaactaatcgatctgcaagggcaattgctgcattt
gagggaagaactgaagtgcaagaggaagatatagctagagttattacatgttctttaagg
catcgattaagaaaagatcccttagagcaagttgattcaggagaaagagtcatccaagca
ttctgtaaagtcttcgatttgaatgaaaaagaagacctttccaaatttcaattatcatca
caagaataa

DBGET integrated database retrieval system