KEGG   Prochlorococcus marinus MED4: PMM1081Help
Entry
PMM1081           CDS       T00142                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pmm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1023724..1025244
Genome map
AA seq 506 aa AA seqDB search
MSLKSVLKNKSLGILVHPSSLPGGSYCGTFGEGAKDWIKKLCKYKINHWQFLPLTPTDST
GSPYSSPSSFALNPWFLDINKLIEENFIISLNKKDLQSINQNEDHFDFDYANNLSKKLGE
YLLFDWESQSEMRKTDFYLWNKKNTWVEDYSIFMVLREKFNMLPWWEWPLEFKQKENEFI
KTWIKDKKNEILKTKLIQWHLDKQWKEIKVFAKTNGITLIGDLPFYVSRDSVDVWSNKSL
FSISQNGDLLFQSGVPPDYFSSTGQLWGTPTYYWAKHKSTAFRWWRKRFKRQFELVDILR
LDHFRALAGYWRVDGNAQNAINGSWINSPGKELLNLLKKDLKSDYLPIIAEDLGVITKDV
EILRDNYELPGMKILQFAFDGNDNNPYLPKNIEKENWVVYTGTHDNATSTSWWDCLDITI
KTHIKDKYKYSIDPSWNLMEIGMSTKANLFISPIQDILSLDDSSRLNTPGTITNNWRWKL
NQTLDEIDMNLKKYSDLGNNYGRLSN
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaaaatcagttctaaaaaataaatcgttaggtatacttgttcatccttcaagt
cttcccggaggtagttactgcgggacctttggagaaggcgctaaagattggattaagaag
ctttgtaagtataagattaatcactggcaattcttacctcttactccaacagattcaact
ggatctccttatagttcgccatccagttttgcgttaaatccttggtttcttgatatcaat
aaattgattgaagaaaactttatcatttcattaaataaaaaggatttacaatcaattaat
cagaacgaagatcattttgattttgattatgcaaataatttatcgaaaaaattaggagaa
tatcttttatttgattgggaatctcaatctgaaatgagaaaaactgatttttatttatgg
aataaaaaaaatacttgggttgaagattattcaatctttatggtcttaagagagaaattc
aatatgttgccatggtgggagtggccattggagtttaagcaaaaggaaaatgaatttata
aaaacatggataaaagacaaaaaaaatgaaatacttaaaacaaaattaatacaatggcat
cttgataaacagtggaaggaaatcaaagtctttgccaaaactaatggaattacactaata
ggtgatttgcctttttatgtttcaagagacagtgtggatgtatggagtaataaatcacta
ttttctatctctcaaaatggagatttactttttcaaagtggagtgcctcctgattatttc
tcatctacgggacaactatggggtactcccacttactattgggctaagcacaaaagtaca
gcatttagatggtggagaaaaagatttaagagacaatttgaacttgttgacatattaaga
cttgatcattttagagcgttggctggatattggagagttgatgggaatgcccaaaatgct
attaatgggtcatggattaattcccctgggaaagagctattaaatcttttaaaaaaagat
ttaaaatctgattatctacctatcattgctgaggatttaggagtaataactaaagatgta
gagatattaagggataattatgaattacctggtatgaagattttacaattcgcattcgat
gggaatgacaataacccttatctacctaaaaatatcgaaaaagagaactgggttgtttat
acaggaacccatgataacgctacctccacatcgtggtgggactgtttagatattacaatt
aaaacccatattaaagataaatataaatactcaattgatccctcttggaatttaatggaa
attggcatgagtacaaaagcaaacctttttatctctccaattcaagatatcttatctttg
gacgattcaagtagattaaatacacctggtacaattactaacaattggagatggaaatta
aatcaaactcttgacgagatagatatgaatttaaaaaaatatagtgaccttggaaataat
tatgggagattaagcaattag

DBGET integrated database retrieval system