KEGG   Prochlorococcus marinus subsp. pastoris CCMP1986: PMM1081Help
Entry
PMM1081           CDS       T00142                                 

Gene name
malQ
Definition
(GenBank) Putative 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pmm  Prochlorococcus marinus subsp. pastoris CCMP1986
Pathway
pmm00500  Starch and sucrose metabolism
pmm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PMM1081 (malQ)
Enzymes [BR:pmm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PMM1081 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: CAE19540
CYORF: PMM1081
UniProt: Q7V110
Position
1023724..1025244
Genome map
AA seq 506 aa AA seqDB search
MSLKSVLKNKSLGILVHPSSLPGGSYCGTFGEGAKDWIKKLCKYKINHWQFLPLTPTDST
GSPYSSPSSFALNPWFLDINKLIEENFIISLNKKDLQSINQNEDHFDFDYANNLSKKLGE
YLLFDWESQSEMRKTDFYLWNKKNTWVEDYSIFMVLREKFNMLPWWEWPLEFKQKENEFI
KTWIKDKKNEILKTKLIQWHLDKQWKEIKVFAKTNGITLIGDLPFYVSRDSVDVWSNKSL
FSISQNGDLLFQSGVPPDYFSSTGQLWGTPTYYWAKHKSTAFRWWRKRFKRQFELVDILR
LDHFRALAGYWRVDGNAQNAINGSWINSPGKELLNLLKKDLKSDYLPIIAEDLGVITKDV
EILRDNYELPGMKILQFAFDGNDNNPYLPKNIEKENWVVYTGTHDNATSTSWWDCLDITI
KTHIKDKYKYSIDPSWNLMEIGMSTKANLFISPIQDILSLDDSSRLNTPGTITNNWRWKL
NQTLDEIDMNLKKYSDLGNNYGRLSN
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaaaatcagttctaaaaaataaatcgttaggtatacttgttcatccttcaagt
cttcccggaggtagttactgcgggacctttggagaaggcgctaaagattggattaagaag
ctttgtaagtataagattaatcactggcaattcttacctcttactccaacagattcaact
ggatctccttatagttcgccatccagttttgcgttaaatccttggtttcttgatatcaat
aaattgattgaagaaaactttatcatttcattaaataaaaaggatttacaatcaattaat
cagaacgaagatcattttgattttgattatgcaaataatttatcgaaaaaattaggagaa
tatcttttatttgattgggaatctcaatctgaaatgagaaaaactgatttttatttatgg
aataaaaaaaatacttgggttgaagattattcaatctttatggtcttaagagagaaattc
aatatgttgccatggtgggagtggccattggagtttaagcaaaaggaaaatgaatttata
aaaacatggataaaagacaaaaaaaatgaaatacttaaaacaaaattaatacaatggcat
cttgataaacagtggaaggaaatcaaagtctttgccaaaactaatggaattacactaata
ggtgatttgcctttttatgtttcaagagacagtgtggatgtatggagtaataaatcacta
ttttctatctctcaaaatggagatttactttttcaaagtggagtgcctcctgattatttc
tcatctacgggacaactatggggtactcccacttactattgggctaagcacaaaagtaca
gcatttagatggtggagaaaaagatttaagagacaatttgaacttgttgacatattaaga
cttgatcattttagagcgttggctggatattggagagttgatgggaatgcccaaaatgct
attaatgggtcatggattaattcccctgggaaagagctattaaatcttttaaaaaaagat
ttaaaatctgattatctacctatcattgctgaggatttaggagtaataactaaagatgta
gagatattaagggataattatgaattacctggtatgaagattttacaattcgcattcgat
gggaatgacaataacccttatctacctaaaaatatcgaaaaagagaactgggttgtttat
acaggaacccatgataacgctacctccacatcgtggtgggactgtttagatattacaatt
aaaacccatattaaagataaatataaatactcaattgatccctcttggaatttaatggaa
attggcatgagtacaaaagcaaacctttttatctctccaattcaagatatcttatctttg
gacgattcaagtagattaaatacacctggtacaattactaacaattggagatggaaatta
aatcaaactcttgacgagatagatatgaatttaaaaaaatatagtgaccttggaaataat
tatgggagattaagcaattag

DBGET integrated database retrieval system