KEGG   Prochlorococcus marinus MED4: PMM1102Help
Entry
PMM1102           CDS       T00142                                 

Gene name
recD
Definition
exodeoxyribonuclease V (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PMM1102 (recD)
Enzymes [BR:pmm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PMM1102 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1046989..1048677)
Genome map
AA seq 562 aa AA seqDB search
MNHTNLDIEAFQYNHIFNLLQDIFGFNEIKDGDFVKDTLKILLEFEKNGETIVEVDKRLI
LFDLLKDGWPNEHLKVLKDLGLLNSFNSPFIFSDRKLSLAKWSGKINRVINIFLKKIDKI
PIKINDDNKLHQIKNIFKSSNLVFLQGGPGTGKTTLIINFILNSLKSDRFLNIGLAAPTG
KATSRLKESLNEQKDIIFSKSLDQIECQTLHKWIFYSEHKAIKLKFKLKELDIFIIDEMS
MVNIDIIELILDLLAKDCKIILVGDKNQLPPVKNSSIWNYLFEYSNNEVIKSCIVNLNKT
YRNSGDIELLSNLIFNPTDSLFKKKIKELENDKKSKEVNILKSINKNIPLGLLNEIKDYI
NKLRISTSNLSKKEYIFQKTFRDLMSHEKDLINNIFTDLQSHLILCEKNTGTWSVENIND
IVLGQRKPYDFTSLEEGIPIMCTENNNELGISNGDIGVLIGKNENRKFLFRKFNDNNDLV
VDFIEPSTLDNVVPAIAITIHKSQGSESEKVSILWTQKSQINNYKEDLKESKLIFFRDSY
EKRLLYTAITRAKNFLDIYFLN
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatactaatttggatatagaagcatttcaatataatcatatatttaatctcctc
caggatatttttggatttaatgaaataaaagatggagatttcgtaaaagatactttaaaa
atattattagaatttgagaaaaatggtgaaactattgtagaagttgataaaaggttaata
ttatttgatttattaaaagatggatggcctaatgaacatttaaaagttctcaaagattta
ggattgttaaactcctttaattccccatttatatttagtgataggaaattatcattagca
aaatggtctggaaagataaatagagttataaatattttcttaaagaaaatagataaaatc
cccataaaaataaatgatgataataaacttcatcaaattaaaaatatttttaaaagttca
aatttagtatttctgcaaggaggaccaggaacaggcaaaacaactttaattataaacttt
atattaaattctttaaaaagtgaccgttttttaaatataggactcgcagcacctactgga
aaagccacctctagactaaaagaatctcttaatgaacaaaaagatataatttttagtaaa
agtcttgatcaaatagaatgtcaaactttacataaatggattttttattctgaacataaa
gctattaaattaaaatttaaattaaaggaattagatatttttattattgatgaaatgtca
atggtaaatattgatattattgaattgattttagatttattagctaaagattgtaaaata
atcctagttggtgataaaaatcaattacctccagtaaaaaattcctctatatggaattat
ttattcgaatattctaataatgaggtaatcaaatcttgtatagtaaatctcaataaaact
tatagaaatagtggggatattgaattacttagtaatcttatttttaatcctacagattcc
ttatttaagaaaaagataaaagaattagaaaatgataaaaaatcaaaagaagttaatatc
ttaaaaagcattaataagaatattcctctaggattattaaatgaaattaaagattacatt
aataaattacgaatttcaacatcaaacttaagtaaaaaagaatatatctttcaaaaaaca
tttagagatttaatgagccatgaaaaagacttaataaataatatttttacagatttacaa
agtcaccttatcctttgtgagaagaatactgggacatggagcgttgagaatataaatgat
atcgttttaggccagagaaaaccttatgactttactagccttgaagaagggatccccata
atgtgtactgaaaataataacgaactcggaatttcaaatggagatattggagtcttaata
ggaaaaaatgaaaaccggaaatttctatttaggaaatttaatgataataacgatcttgta
gttgactttattgaaccatcaactcttgataacgtcgtgccagcaattgctatcactatt
cataaatctcaaggaagcgaatctgaaaaagtaagtattttgtggacccaaaaatctcaa
attaacaattataaggaagatctgaaagaaagcaaattaattttctttagagatagttat
gaaaagagattactatataccgcaattacaagagcaaagaattttctggatatttatttt
cttaattaa

DBGET integrated database retrieval system