KEGG   Prochlorococcus marinus MED4: PMM1142Help
Entry
PMM1142           CDS       T00142                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pmm00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1094783..1095997
Genome map
AA seq 404 aa AA seqDB search
MLGSTGSIGTQTLEIVSELPDKFKVVALSAGRNIDLLTEQVSQHKPEVIAIEDENLLTDL
KNNINNLGISNPPIVLGGREAINSVAAWDSADTVITGIVGCAGLIPTMSAIKAGKNIALA
NKETLIAAGSVVIPALKESKSRLLPADSEHSAIFQCIQGLPNYENADFSTGQIPNGLKAI
HLTASGGAFRDWEVEDLKNVTVEDATSHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGT
SYENIEIAIHPQSIIHSMIEMEDSSVLAQLGWPDMKLPILYAMSWPERFKTNWKRFNLTE
IGQLTFKKPDEVKYPCMGLAYSAGKCSGTMPAVLNAANEMAVDQFLKEKISFQEIPIFIN
KTCESHLNKINLNPKLEDILEVDNWARIFVQEEIKKGKKYINVG
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgctgggttcaacaggttcaattggaacccaaactctcgaaatagtaagtgaactgcct
gataaattcaaagtagtagctctttcagcagggagaaatatagacttattgacggagcaa
gttagtcaacataaaccagaagttattgctattgaggatgaaaatcttttaacagattta
aaaaataatattaacaatttaggaataagtaatcctcctatagttttaggtggtcgagag
gcaattaattcagtggcagcatgggattctgccgatactgtaattactggaatagtagga
tgtgctggacttattccgacgatgtcagctattaaggctggtaaaaatattgcgcttgcc
aataaagaaaccttaattgccgcggggtctgttgttatacctgctttaaaggaaagcaaa
agtagacttttacctgcggactctgagcattcagctatctttcaatgcatacaaggatta
cctaattatgaaaatgccgatttttcaacaggtcaaatcccaaatggtttaaaagctatt
catttaactgcatcaggaggtgcttttagagattgggaagtagaggatttaaaaaatgtc
acagtggaagatgcgacttcccatccaaattggagtatggggagaaaaataactgtagat
tctgccactcttatgaacaaaggattggaggttattgaagcacattatctttttgggacg
tcttacgaaaatattgaaattgctatacatcctcaaagtattattcattcaatgattgag
atggaagattcttctgtcctagctcaattaggatggcctgatatgaagctcccaatttta
tatgcaatgagttggccagaaaggttcaaaactaattggaaaagatttaatttaactgag
attgggcaacttacatttaaaaaaccggacgaagtaaaatatccatgtatgggacttgca
tattcagcagggaaatgttcaggaacaatgcctgcagtacttaatgctgcaaatgaaatg
gcagtagatcaatttctaaaagaaaaaatttcttttcaagaaattcctatctttataaat
aaaacttgtgaatcacatttgaataaaatcaacttaaacccaaagttagaagatattcta
gaggttgataattgggcgaggatttttgttcaagaagagataaaaaaaggcaaaaaatat
atcaacgtaggttaa

DBGET integrated database retrieval system