KEGG   Prochlorococcus marinus MED4: PMM1192Help
Entry
PMM1192           CDS       T00142                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pmm00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1139010..1139951)
Genome map
AA seq 313 aa AA seqDB search
MRRWLFNIHLVIKLPSGVYLENLIDDLRAFSWEAYETLIYYSKIVKDSNNKSNILKNDNL
DDPVTKADLKVNEVIIKRINEKYKDINWEILSEENVKLTSESCNNNADWIWVLDPLDGTK
DFIQGTGNYAMHLALNYKNKPYIGIVLIPDKDELWITDGEKVWGEKKDGSKIKPNLSTNK
SLKDMSLVTSKNHRNEIIKKLIQKIDFYKVITMGSIGCKIASIIRGESDIYISLSLMGKS
SPKDWDFAAPEAILKTAGGVITNLDNQELIYGKSNFEQGGIIVASSNINTHKDICTEIKE
IIKKYDIYPLRIN
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatggttgtttaatattcatttagtgattaaattaccctctggtgtttatctt
gaaaatcttatcgatgatttacgggcttttagctgggaagcttatgaaaccttaatttat
tactctaaaatagtaaaagattcaaacaacaaaagcaatatactaaaaaatgataattta
gatgatccagtaacaaaggcagatttaaaagttaatgaggtaatcattaaaagaattaat
gaaaaatataaagacattaattgggaaattttaagtgaggaaaacgtaaaattaacctct
gaaagttgtaataataatgctgattggatttgggttcttgaccctcttgatgggactaag
gattttattcaagggacagggaactatgcaatgcatctagctttaaattataagaataag
ccatatattggaattgttttaataccagataaagatgaattatggattacggatggagaa
aaagtttggggagaaaaaaaagatggatcaaaaattaaacccaatttatctacaaacaaa
agtcttaaagatatgagtttagtaacaagtaaaaatcatagaaatgaaataataaaaaaa
ttaattcaaaaaattgatttttataaagtaattacaatgggaagtataggctgtaagatc
gcatcaatcatcagaggagaaagcgatatttatataagtttgagcctaatggggaaaagc
tcccctaaagattgggattttgctgcaccagaagctattttaaaaacagcaggaggagta
attacaaatttagataatcaagaacttatttacgggaaatcaaatttcgagcaagggggt
atcatcgttgcatccagtaatatcaatactcataaagatatatgtactgaaattaaggaa
attatcaaaaaatacgatatataccctttaagaattaattaa

DBGET integrated database retrieval system