KEGG   Prochlorococcus marinus MED4: PMM1377Help
Entry
PMM1377           CDS       T00142                                 

Definition
dihydroflavonol-4-reductase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
pmm  Prochlorococcus marinus MED4
Brite
Enzymes [BR:pmm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     PMM1377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1324267..1325262
Genome map
AA seq 331 aa AA seqDB search
MEKVLVTGASGFIAIHCIHELIKAGYLVKGSLRNMNREDEVRKSLDKDSDNHKLEFCKLD
LLDNEGWDEAASDCDYLLHVASPFTIEEPKKESILIKPAVEGTLRALNASKNSSKVKKVV
LTSSMAAIAYGHDKQLCSPEDWTDTTKNVGAYVKSKTIAEKAAWDFIHNDTEHSFSMTTI
HPGMVFGPLLSDDNDGASAELISKMINGKFPALPDAYFTVVDVRDVAKLHVESLRKNQSD
NKRIIATSPQGINIMEISNILRKNGYKKAPQNFIPTKMINSLAPFNKEMKSMAAMVNRGS
YGADITETISIYNWEPISLEKTLIDMGNSIK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaagttttagttactggtgcatctgggtttattgctattcactgcatacatgag
ctaataaaagcaggttatcttgtcaaaggatctctaagaaatatgaatagagaagatgaa
gtaagaaaatctcttgataaagattcagataatcataagctggaattttgtaaacttgac
cttctagataatgagggatgggatgaggcagcctctgattgtgattatcttcttcatgtt
gcatctccttttactatcgaagagccaaaaaaggaatctattcttattaagcccgcagta
gagggaactttaagagcgttgaatgcttcaaaaaattcctctaaagtcaagaaagttgtc
ctaacttcttcgatggctgcaattgcatatgggcatgacaagcagttatgctcgcctgaa
gactggacagatacaacaaaaaacgttggtgcatatgtaaaaagtaaaacaattgcagaa
aaagctgcatgggattttattcataatgacactgaacactctttttcaatgacaactatt
catcctggaatggtttttggtccactgctaagtgatgataatgatggtgcttcggcagaa
cttatttcaaaaatgattaatggtaaatttccagcactaccagatgcatattttactgtc
gtagatgtaagagatgtcgccaagttacatgtcgaatctcttagaaaaaaccaaagtgat
aataaaagaattattgcgacttctcctcaagggatcaatattatggaaatttctaatatt
ttaagaaaaaatggctacaagaaagcacctcaaaactttatccctacaaaaatgataaat
tctctagcaccatttaataaagagatgaaaagtatggctgccatggttaatagaggatct
tatggcgctgatattacggaaactatttctatatataattgggaacctatttcattagaa
aaaactttaatagatatgggtaattctataaaataa

DBGET integrated database retrieval system