KEGG   Prochlorococcus marinus MED4: PMM1686Help
Entry
PMM1686           CDS       T00142                                 

Definition
(GenBank) Arginase family
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
pmm  Prochlorococcus marinus MED4
Pathway
pmm00330  Arginine and proline metabolism
pmm01100  Metabolic pathways
Module
pmm_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PMM1686
Enzymes [BR:pmm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PMM1686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: CAE20145
CYORF: PMM1686
UniProt: Q7UZH9
Position
1619220..1620104
Genome map
AA seq 294 aa AA seqDB search
MINKNLFDNESAIFMGAKRNPDDCSIGIFGVNYDGTCSYKSGTRFGPNAIRLVSTCLETF
CPRLGKDLEDFNYVDFGSLEIDKNDSISVIKAVKSATDFIMSSKLTPIMLGGEHSITSGA
IEALVNRYPDLILIQLDAHADLRTSYMGNEHSHACAMQRCLDILPEKKILQVGIRSGTKE
EFKFMSQKKQLVKFLPGGNAQEFKKALLPYSNSPIYLTIDLDWFDPSLLPGTGTPEPGGF
FWNDFEVILETLKEFRIVASDIVELSPEIDNSGVSSIVAAKVLRSLIMSVQNMQ
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgatcaataaaaatttatttgataacgaaagtgcaatttttatgggagccaaaagaaat
ccagatgattgttcaattggaatatttggagtcaattatgacggtacatgctcttataag
tcagggactagatttggtccaaatgccataaggctagtaagcacatgcttagagacattt
tgtccaagattaggaaaggatttagaagattttaattatgttgattttggttcactagaa
atagataaaaatgactcaatatctgtcattaaagcagtcaaatcagcaacagatttcatt
atgagtagcaagcttactcccattatgcttggaggtgagcactctattactagtggtgct
attgaggcgttagtaaatagatatccagatctgattttaattcaactagatgctcatgca
gatctaagaacctcatatatggggaatgaacatagtcatgcttgtgcaatgcaaagatgc
ttagatattttacctgaaaaaaagattttgcaagtcggaataagaagtggtaccaaagaa
gaatttaaatttatgagtcaaaaaaagcaattagtaaaattcttgccaggagggaatgct
caagaatttaaaaaagcccttcttccttactctaattcgccaatatatttaacaatagat
ttggattggtttgatccaagtttattacctggtacgggaactccagaaccaggaggtttt
ttttggaatgactttgaagtaattcttgaaactctaaaagaatttagaattgtcgcttca
gatattgtggaattatctccagaaattgacaatagcggagttagtagtatagttgccgca
aaagtactgagaagcttaattatgtcagtacaaaatatgcaataa

DBGET integrated database retrieval system