KEGG   Prochlorococcus marinus MED4: PMM1716Help
Entry
PMM1716           CDS       T00142                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pmm  Prochlorococcus marinus MED4
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PMM1716 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMM1716 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PMM1716 (thrC)
Enzymes [BR:pmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PMM1716 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1656714..1657817
Genome map
AA seq 367 aa AA seqDB search
MSILNKIKNKFSFNYRKKRWPGLINAYKQYLPVSSKTPIISLNEGNTPLILSKSISDLIG
NDTKVYLKYDGLNPTGSFKDRGMTMAISKAKEEGREAVICASTGNTSAAAAAYASRGGLK
SYVLIPDGYVAQGKLAQALMYGAEIISIQGNFDKALEIVRKLSSEYPINLVNSVNPYRIQ
GQKTAAFEIVDDLGIAPDWLCIPMGNAGNITAYWLGFKEYAKIKKNLKLPLMMGFQSEGS
APLVKNIIVQDPETIATAIRIGNPVNRDKAKIVKKESKGDFQSVTDEEIIVAYKMLAKEG
IFCEPASAASVAGLIKNKNRIKKESTIVCVLTGNGLKDPDCAIKNNDAIFQKNIEPSLKN
ITKILGY
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatattaaataaaattaaaaacaaattttcttttaattacagaaaaaaaagatgg
ccaggattaatcaatgcatataaacaatatctaccagtttcctctaaaactcccatcata
tccttaaatgaaggaaatactcctcttattctcagcaaatcaattagtgatttaattgga
aacgatactaaagtttatttaaaatatgatggtcttaaccccactggttctttcaaggac
agaggtatgacgatggcgataagtaaagcaaaggaggaaggacgtgaagcggtaatatgc
gctagtacaggaaatacttctgcagctgcagcggcttatgcttcaagaggtggtttaaaa
tcttatgtattaattccagatggatatgtagctcaaggaaaacttgctcaagctttaatg
tacggagcagaaatcatatctatacaaggtaattttgataaagctttagaaattgtcagg
aagttgtcttccgaatatccgattaatcttgtaaattctgtaaatccttaccgaatacaa
ggtcaaaagactgcagcatttgaaatagtagatgacttaggtattgctcctgattggcta
tgtataccaatgggtaatgcgggtaatataaccgcttattggttgggttttaaagaatat
gcaaaaattaagaaaaatttaaaattgccattaatgatgggatttcaatctgaaggatct
gcacctttagtgaaaaatattatagttcaagatcctgaaacaatcgcgacagctattcga
attggaaatcctgtaaatagagataaagcaaaaatcgttaaaaaagaaagtaaaggagat
tttcaatctgtaactgacgaagagattattgtagcttataaaatgcttgcaaaagaaggt
attttctgtgaaccagcaagcgcagcttcagtggcgggacttattaaaaataaaaacaga
ataaaaaaagaatcaacaatagtttgtgtattaacaggaaatggattaaaagatccggat
tgtgcgattaaaaataacgatgctatatttcagaaaaatattgaaccttcgttaaaaaac
ataacaaaaattttgggatactaa

DBGET integrated database retrieval system