KEGG   Prochlorococcus marinus NATL2A: PMN2A_0008Help
Entry
PMN2A_0008        CDS       T00267                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PMN2A_0008 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMN2A_0008 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PMN2A_0008 (trpA)
Enzymes [BR:pmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PMN2A_0008 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
558019..558834
Genome map
AA seq 271 aa AA seqDB search
MKSTNISRSFSKIKKEKRIALMPFLMAGDPDLETTAKILLELQANGADMIELGIPYSDPL
ADGPIIQLAASRALSAGTSPDRVFKMLFELRDQLTIPIILFTYSNPLINKGLEEFCLQAS
KVGVSGLVVPDLPLEEAEKLSDIAESKEIDLVLLVAPTTPKDRMKRIAATSNGFTYLVSV
TGVTGERSSLEDNVGSLVQQLKDSSSSPIAVGFGISDVKHIEQVREWGADGAIVGSALVK
RIANASIEMKVEEAGSFCKELRAATNEYFFK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaagtacaaatatcagtaggtctttttccaaaataaaaaaggagaaaagaattgca
ctaatgcctttccttatggcaggtgaccctgatttggaaactacagcaaagattttgtta
gagcttcaggcaaatggcgctgacatgattgagctaggcattccatacagtgatccttta
gcagatggtccgattattcaattagcagcttctcgagctctttctgcaggaacctcccct
gacagggtttttaaaatgttgtttgaattgagagatcaattgacaataccaataatttta
tttacttactcaaacccacttattaataaaggtctggaagaattttgcttgcaagcatcg
aaagtaggtgtttcaggacttgtcgtaccagatcttcctctagaggaagcagaaaaactt
tctgatattgctgaatctaaggaaattgatttggttttacttgttgctcctacaacccca
aaggatcgtatgaaaagaatcgcagcgacttctaatggattcacttatcttgtaagtgtt
actggggtgactggagaaaggtcatcattagaagataatgtaggatctcttgtgcaacaa
ctaaaagattcttcatctagtccaattgctgtgggctttggaatttcagatgtaaaacac
attgaacaagttagagaatggggcgctgatggcgcaattgttggtagtgctttagttaaa
agaattgctaatgcctcgatcgaaatgaaagtcgaagaagctggttctttttgtaaagaa
ctaagagccgcaactaatgaatatttttttaaatag

DBGET integrated database retrieval system