KEGG   Prochlorococcus marinus NATL2A: PMN2A_0020Help
Entry
PMN2A_0020        CDS       T00267                                 

Definition
(GenBank) glycogen branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn00500  Starch and sucrose metabolism
pmn01100  Metabolic pathways
pmn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PMN2A_0020
Enzymes [BR:pmn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PMN2A_0020
Exosome [BR:pmn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PMN2A_0020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AAZ57512
CYORF: PMN2A_0020
UniProt: Q46LW6
Position
complement(568452..570719)
Genome map
AA seq 755 aa AA seqDB search
MTVSILLDSLKDDGQRLSECRHESPFSILGPQPFKDKWIIRIWMPEASQVELVTQQTKIK
LQNPNHEWIFEGVLEKDPGTDYQIKVNRGGIEHVQHDPWSFRKEWMGEIDRHLFAEGNHH
HIWRKMGAHLTEIDKKKGVMFCLWAPHAKSVSVIGDLNSWDGRHHPMQKRLGGIWELFIP
GLSEGDLYKYEIRTEKGHCYEKADPYGFQHEVRPAKSSVISKIDSFQWSDQSWISNRDNR
DPLEQPISVYEMHLGSWMHASSDDPFINSNGEHRAPVPAADMKPGSRLLTYKELANKVIP
YVKERGFTHIELMPISEHPFDGSWGYQVTGWYAPTSRFGSPDEFRAFVDSCHKEGIGIIL
DWVPGHFPKDQHGLAYFDGSHLYEHSDPRVGEHKEWGTLIFNYSRNEVRNFLVANLIFWF
DQFHIDGIRVDAVASMLYKDYLRPEGEWIPNEDGGNENFEAVRFLQQANHVLFQHFPGAL
SIAEESTTWTGVTKPTDMDGLGFNLKWNMGWMHDMLDYFEIDPWFRQFNQNNITFSICYN
FTENFMLALSHDEVVHGKSHLLHKMPGDDWQKYANTRALLAYMWTHPGKKTIFMGMEFGQ
RQEWNVWDDLQWDLLNYEPHKGIQKLVDDLNNLYKREPALWRNDFDEYGFQWIDCDDNKN
SVISFMRREKTDGEWLVIVANFTPQNHSNYRIGVPVDGFYEEIFNTDASQYGGSNLGNMG
GKSTDLYNIHGYENSIDLCLPPLSVLVLKHKSKKN
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtctctattctattagattctttgaaagacgacggacaaagactttctgaatgc
agacatgaaagtccattttcaattcttggccctcaaccatttaaagataaatggatcatt
cgaatatggatgcctgaggcaagtcaagttgaactggtaacacaacaaactaaaattaag
ctacaaaatcccaatcatgaatggatatttgagggggttttagaaaaagatccaggtact
gactatcaaataaaagtaaatagaggaggaattgaacatgttcaacatgatccttggagt
ttccgaaaagagtggatgggtgaaattgatagacatcttttcgcggagggaaatcaccat
cacatatggcgaaaaatgggtgctcatctcacagaaatagataaaaagaaaggagttatg
ttttgcttatgggcgcctcatgcaaagagtgtttccgttattggtgatctcaattcatgg
gatggacgccatcacccaatgcaaaaacgtctaggaggaatttgggaactattcatacct
ggtctaagtgagggagatttatacaaatatgaaatcaggactgaaaaaggacattgctac
gagaaagccgacccttatggttttcaacatgaagtaagaccagcaaaaagctcagttata
tcaaaaatcgactcatttcaatggagtgatcagtcttggatatccaatcgtgacaataga
gatcctttagagcaaccaatttcggtttatgaaatgcatttaggaagctggatgcatgct
tcctcggacgatccatttatcaactcaaacggagagcatagagctccagttccagctgca
gatatgaagcctggctcaagattgcttacatataaagaactggcaaataaggtcattccc
tatgtcaaagaaagaggcttcactcatatcgagcttatgccaatttcagagcaccctttt
gatgggtcatgggggtatcaagttacaggttggtatgcgcctacaagtagatttggatca
ccagatgagtttcgtgccttcgttgattcatgtcataaagaaggaataggaatcattctc
gattgggtcccgggccacttccctaaagatcagcatggactagcttattttgatggcagc
catctatacgagcattcagatccaagagttggagagcataaagaatggggaacattaatt
ttcaattacagtcgaaatgaagttcgtaattttctagttgcaaatctaattttctggttt
gatcaatttcatatagatggcatacgtgttgatgcagttgcctcaatgctttacaaagac
tatcttcgtccagagggtgaatggatacctaatgaagatggagggaatgaaaattttgaa
gcagtcagatttctacaacaggctaatcacgttctttttcaacattttccaggtgcactt
tctattgcagaagaatcaacgacatggactggtgtaaccaaaccaactgacatggatgga
ctcggtttcaatctaaaatggaacatgggttggatgcacgatatgctcgattattttgaa
attgacccatggtttagacaattcaatcaaaacaacattactttctccatttgttataac
tttaccgaaaactttatgcttgctttaagccacgatgaagttgttcacgggaaaagtcat
ctcttacacaaaatgcctggcgatgactggcagaagtacgctaatacacgagccttactt
gcatatatgtggacacatccaggtaaaaaaacaatatttatgggaatggaatttgggcag
cgccaagaatggaatgtttgggatgatttgcaatgggatcttctaaattatgaacctcac
aaaggaatacagaaattagtagatgatttgaataatttatataaaagagaacctgcttta
tggagaaatgattttgacgaatacggattccagtggattgattgcgatgataataaaaat
tcagtaatcagtttcatgagaagagaaaaaactgatggagaatggctagtaatagtggca
aacttcacacctcaaaaccactccaattacagaataggtgtgcctgttgacggattctat
gaagaaattttcaatacagatgcgagtcaatatggaggttcaaacctaggtaatatggga
gggaaatcaacagatctatacaacatacatggctatgaaaattctatagatctttgcctt
cctcctcttagcgttctggttctaaagcataaatccaagaagaattaa

DBGET integrated database retrieval system