KEGG   Prochlorococcus marinus NATL2A: PMN2A_0032Help
Entry
PMN2A_0032        CDS       T00267                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PMN2A_0032
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMN2A_0032
   00052 Galactose metabolism
    PMN2A_0032
   00500 Starch and sucrose metabolism
    PMN2A_0032
   00520 Amino sugar and nucleotide sugar metabolism
    PMN2A_0032
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PMN2A_0032
   00524 Butirosin and neomycin biosynthesis
    PMN2A_0032
Enzymes [BR:pmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PMN2A_0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(584817..585842)
Genome map
AA seq 341 aa AA seqDB search
MNLLAGDLGGTKTILAIYSNEKYPKKLFEKYYISSEWKSFYSLFEDFIKHLPDHISLPQN
GSIGVAGPIQNQEVKITNLGWDIESKKLSLLSKINNIELINDFSVLIYGIPFFNRNQYEV
IQGTLNSDYKNNQKLIAIIGAGTGLGMSRGLITPKSISIFPSEGGHREFSPRTENEWALV
KWLKKKLNIQRISIERIVSGTGLGMIARWKLDDPINESHPLQVILKNMDSDKSDSTDLPA
LVWEKAKNGDKLMTEALQLWLNAYGSAAGDLALQELCSSGLWIAGGTAAKNLDGINSSNF
LSAFSNKGRFQSYLKEIPLVVLKDKEATLFSSACRARLIAE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacttgctggagaccttgggggaactaaaacaatattagctatttattcaaac
gagaaatatccaaaaaaattatttgagaagtactatatttcatcagaatggaaatctttt
tactcattatttgaagattttattaaacatttaccagatcatatatcactgcctcaaaat
ggttctattggtgtagccgggccaatacaaaatcaggaggttaagattacaaatcttggc
tgggatatcgaatcaaaaaagttatctctactttcaaaaataaataatattgaattaata
aatgatttttcagttttaatctatggaataccatttttcaatagaaaccaatatgaagta
atacaagggacattaaattctgattacaaaaacaatcaaaaattaattgcaattatcgga
gctggtactggcttaggaatgtccagaggcttgataacccctaaaagcatctctatattt
ccaagtgaaggagggcatcgagaattttccccaagaacagaaaacgaatgggcattagtc
aaatggctaaaaaagaagttaaatattcaaagaatatccattgaaagaattgttagtggt
actggccttggcatgattgccagatggaaattggatgatccaataaatgaaagccatcca
cttcaggtaattttaaaaaatatggatagtgacaaatcagattccacagatttacccgca
cttgtttgggaaaaagcaaaaaacggagacaaattaatgactgaagccttgcaactatgg
ctaaatgcttatgggtctgcagctggagaccttgctttacaagaactttgctcttcaggc
ttatggatagcaggtggaacagcagcaaaaaacctcgatggaataaactcttctaacttc
cttagtgcatttagtaataagggtcgctttcaatcttatttaaaggaaattccattggtt
gttcttaaagataaagaagcgacattattcagctcagcttgcagagcacgcttaattgcc
gaataa

DBGET integrated database retrieval system