KEGG   Prochlorococcus marinus NATL2A: PMN2A_0057Help
Entry
PMN2A_0057        CDS       T00267                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn00010  Glycolysis / Gluconeogenesis
pmn00620  Pyruvate metabolism
pmn00640  Propanoate metabolism
pmn00680  Methane metabolism
pmn01100  Metabolic pathways
pmn01110  Biosynthesis of secondary metabolites
pmn01120  Microbial metabolism in diverse environments
pmn01130  Biosynthesis of antibiotics
pmn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMN2A_0057
   00620 Pyruvate metabolism
    PMN2A_0057
   00640 Propanoate metabolism
    PMN2A_0057
  Energy metabolism
   00680 Methane metabolism
    PMN2A_0057
Enzymes [BR:pmn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PMN2A_0057
Lipid biosynthesis proteins [BR:pmn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PMN2A_0057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AAZ57549
CYORF: PMN2A_0057
UniProt: Q46LS9
Position
612073..614049
Genome map
AA seq 658 aa AA seqDB search
MNSNNSNSIESVLQEQRVFPPSDNFSSKSRISSFSKYLEMSEMAKSDPNKFWGDAAREEL
HWFKSFNKVLDWSNPPFAKWFDGGKTNISFNCLDRHLNSSTADKVALIWEGEPGDKKKYT
YKQLHKEVCKAANALKSIGIGKGDLVALYMPMVPEAAIAMLACARIGAPHSVVFGGFSSE
ALRDRLINGEAKAIITADGGFRKDKVIPLKDAVDQALGGGACPKVESVLVVQRTKKNIAM
DDGRDYWWHEIVDSQADDCLPEQMDSEDCLFVLYTSGSTGKPKGVVHSTAGYNLWSHLTF
KWIFDIRENDVYWCTADVGWITGHSYIVYGPLSNGATTVMYEGVPRPSNPGAFWDVIQKH
KISIFYTAPTAIRAFMKAGNKIPNQYDLSSLRLLGTVGEPINPEAWIWYRDVIGGGRCPI
VDTWWQTETGGVMISPLPGATPTKPGSATFPLPGIEADVVNSDGDSVANNEGGYLVVKRP
WPGMMRNVYGDEKRFRESYWEYLKPSDNSYMYFAGDGARRDEDGYFWVMGRVDDVINVSG
HRLGTMEIESALVSHELISEAAVVGRPDDLKGESIVAFVTLRTGAEANENIEAQLKKHVV
NEIGPIAKPDEFKFTDSLPKTRSGKIMRRILRALASGDEISGDTSTLEDRSVLDKLRS
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaaacaattctaactctattgagtctgttctacaggagcagagagttttcccc
ccttctgataacttttccagtaaaagtaggatctcatctttttcaaagtatttggaaatg
tctgagatggccaaatcagatccaaataagttttggggtgacgctgctagagaagaattg
cactggtttaaatcttttaataaagtactcgattggtccaatccaccattcgctaaatgg
tttgatggaggaaaaactaatatttcctttaactgcttagatcgtcacttaaatagttca
acggctgacaaagtcgccttgatttgggaaggtgagccaggtgataagaaaaaatatacc
tacaaacaactacacaaagaagtatgcaaagccgccaatgcactcaagtctataggtata
ggtaaaggagatcttgtcgctttgtatatgcctatggttcccgaagctgcaattgcaatg
cttgcatgtgcaaggattggagctccgcattcagtagtatttggaggcttttcctctgag
gcactaagggaccgattaattaatggagaagcgaaagcaataattacagctgatggtggt
tttagaaaagataaagtaattcctctcaaagatgctgttgatcaagcattgggaggtggt
gcttgtccaaaggtcgaatcagttttagttgttcaaaggacaaaaaaaaatatcgccatg
gatgatggtagagattattggtggcatgaaattgtagacagtcaagcagatgattgtttg
ccggaacaaatggatagtgaggattgtttatttgttttgtatacctcaggctctacaggc
aaaccaaagggagtagttcattcaacagctgggtataacctttggtctcatttaactttt
aaatggatttttgatattcgtgaaaatgatgtttattggtgcacggctgatgtgggttgg
ataaccggacatagttatatcgtctatggtccactatctaatggtgcaaccactgttatg
tatgaaggagttcctagaccatcaaatccaggagctttttgggatgtcattcagaagcat
aaaatttcgattttttacactgctccaactgctataagggcttttatgaaagcgggtaac
aagattcctaaccaatatgatttatctagtttgaggcttttaggaactgttggagagcct
attaatccagaggcttggatatggtatcgggatgttattggaggaggtcgatgcccgata
gttgatacatggtggcaaacagaaactggaggagtgatgattagtcctctccctggggcg
acgccaacgaaacctggatcagcaactttccctttacccggaattgaagccgatgtagtc
aattcagatggggattctgtcgctaataatgagggtggatatttggtagtgaaaagacct
tggcctggaatgatgaggaatgtttatggagacgaaaaaagatttagagagagttactgg
gagtatttaaaaccttcagacaatagctatatgtattttgctggagatggggctcgaaga
gatgaagatggttatttttgggttatggggagagttgatgatgttataaacgtctctggt
cataggcttggaacaatggaaatagaatcagctttagttagtcatgagctcatttcagag
gccgcagttgtgggtagacctgatgatttaaaaggagaatcaatcgtagcctttgtaacc
ttgagaactggcgcagaagcaaatgaaaatattgaggcacaattaaaaaaacacgtcgtg
aatgaaataggccctattgctaaacctgatgaatttaagtttactgattctcttcctaaa
acaagaagtggaaaaataatgcgcagaattttgagagcactggcttcaggagatgaaata
agcggagatacaagtacccttgaggatagatcagttttagataaattaagaagttaa

DBGET integrated database retrieval system