KEGG   Prochlorococcus marinus NATL2A: PMN2A_0057Help
Entry
PMN2A_0057        CDS       T00267                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pmn01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pmn00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pmn00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pmn00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:pmn00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
612073..614049
Genome map
AA seq 658 aa AA seqDB search
MNSNNSNSIESVLQEQRVFPPSDNFSSKSRISSFSKYLEMSEMAKSDPNKFWGDAAREEL
HWFKSFNKVLDWSNPPFAKWFDGGKTNISFNCLDRHLNSSTADKVALIWEGEPGDKKKYT
YKQLHKEVCKAANALKSIGIGKGDLVALYMPMVPEAAIAMLACARIGAPHSVVFGGFSSE
ALRDRLINGEAKAIITADGGFRKDKVIPLKDAVDQALGGGACPKVESVLVVQRTKKNIAM
DDGRDYWWHEIVDSQADDCLPEQMDSEDCLFVLYTSGSTGKPKGVVHSTAGYNLWSHLTF
KWIFDIRENDVYWCTADVGWITGHSYIVYGPLSNGATTVMYEGVPRPSNPGAFWDVIQKH
KISIFYTAPTAIRAFMKAGNKIPNQYDLSSLRLLGTVGEPINPEAWIWYRDVIGGGRCPI
VDTWWQTETGGVMISPLPGATPTKPGSATFPLPGIEADVVNSDGDSVANNEGGYLVVKRP
WPGMMRNVYGDEKRFRESYWEYLKPSDNSYMYFAGDGARRDEDGYFWVMGRVDDVINVSG
HRLGTMEIESALVSHELISEAAVVGRPDDLKGESIVAFVTLRTGAEANENIEAQLKKHVV
NEIGPIAKPDEFKFTDSLPKTRSGKIMRRILRALASGDEISGDTSTLEDRSVLDKLRS
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaaacaattctaactctattgagtctgttctacaggagcagagagttttcccc
ccttctgataacttttccagtaaaagtaggatctcatctttttcaaagtatttggaaatg
tctgagatggccaaatcagatccaaataagttttggggtgacgctgctagagaagaattg
cactggtttaaatcttttaataaagtactcgattggtccaatccaccattcgctaaatgg
tttgatggaggaaaaactaatatttcctttaactgcttagatcgtcacttaaatagttca
acggctgacaaagtcgccttgatttgggaaggtgagccaggtgataagaaaaaatatacc
tacaaacaactacacaaagaagtatgcaaagccgccaatgcactcaagtctataggtata
ggtaaaggagatcttgtcgctttgtatatgcctatggttcccgaagctgcaattgcaatg
cttgcatgtgcaaggattggagctccgcattcagtagtatttggaggcttttcctctgag
gcactaagggaccgattaattaatggagaagcgaaagcaataattacagctgatggtggt
tttagaaaagataaagtaattcctctcaaagatgctgttgatcaagcattgggaggtggt
gcttgtccaaaggtcgaatcagttttagttgttcaaaggacaaaaaaaaatatcgccatg
gatgatggtagagattattggtggcatgaaattgtagacagtcaagcagatgattgtttg
ccggaacaaatggatagtgaggattgtttatttgttttgtatacctcaggctctacaggc
aaaccaaagggagtagttcattcaacagctgggtataacctttggtctcatttaactttt
aaatggatttttgatattcgtgaaaatgatgtttattggtgcacggctgatgtgggttgg
ataaccggacatagttatatcgtctatggtccactatctaatggtgcaaccactgttatg
tatgaaggagttcctagaccatcaaatccaggagctttttgggatgtcattcagaagcat
aaaatttcgattttttacactgctccaactgctataagggcttttatgaaagcgggtaac
aagattcctaaccaatatgatttatctagtttgaggcttttaggaactgttggagagcct
attaatccagaggcttggatatggtatcgggatgttattggaggaggtcgatgcccgata
gttgatacatggtggcaaacagaaactggaggagtgatgattagtcctctccctggggcg
acgccaacgaaacctggatcagcaactttccctttacccggaattgaagccgatgtagtc
aattcagatggggattctgtcgctaataatgagggtggatatttggtagtgaaaagacct
tggcctggaatgatgaggaatgtttatggagacgaaaaaagatttagagagagttactgg
gagtatttaaaaccttcagacaatagctatatgtattttgctggagatggggctcgaaga
gatgaagatggttatttttgggttatggggagagttgatgatgttataaacgtctctggt
cataggcttggaacaatggaaatagaatcagctttagttagtcatgagctcatttcagag
gccgcagttgtgggtagacctgatgatttaaaaggagaatcaatcgtagcctttgtaacc
ttgagaactggcgcagaagcaaatgaaaatattgaggcacaattaaaaaaacacgtcgtg
aatgaaataggccctattgctaaacctgatgaatttaagtttactgattctcttcctaaa
acaagaagtggaaaaataatgcgcagaattttgagagcactggcttcaggagatgaaata
agcggagatacaagtacccttgaggatagatcagttttagataaattaagaagttaa

DBGET integrated database retrieval system