KEGG   Prochlorococcus marinus NATL2A: PMN2A_0057Help
Entry
PMN2A_0057        CDS       T00267                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PMN2A_0057
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMN2A_0057
   00620 Pyruvate metabolism
    PMN2A_0057
   00640 Propanoate metabolism
    PMN2A_0057
  Energy metabolism
   00680 Methane metabolism
    PMN2A_0057
Enzymes [BR:pmn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PMN2A_0057
Lipid biosynthesis proteins [BR:pmn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PMN2A_0057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
612073..614049
Genome map
AA seq 658 aa AA seqDB search
MNSNNSNSIESVLQEQRVFPPSDNFSSKSRISSFSKYLEMSEMAKSDPNKFWGDAAREEL
HWFKSFNKVLDWSNPPFAKWFDGGKTNISFNCLDRHLNSSTADKVALIWEGEPGDKKKYT
YKQLHKEVCKAANALKSIGIGKGDLVALYMPMVPEAAIAMLACARIGAPHSVVFGGFSSE
ALRDRLINGEAKAIITADGGFRKDKVIPLKDAVDQALGGGACPKVESVLVVQRTKKNIAM
DDGRDYWWHEIVDSQADDCLPEQMDSEDCLFVLYTSGSTGKPKGVVHSTAGYNLWSHLTF
KWIFDIRENDVYWCTADVGWITGHSYIVYGPLSNGATTVMYEGVPRPSNPGAFWDVIQKH
KISIFYTAPTAIRAFMKAGNKIPNQYDLSSLRLLGTVGEPINPEAWIWYRDVIGGGRCPI
VDTWWQTETGGVMISPLPGATPTKPGSATFPLPGIEADVVNSDGDSVANNEGGYLVVKRP
WPGMMRNVYGDEKRFRESYWEYLKPSDNSYMYFAGDGARRDEDGYFWVMGRVDDVINVSG
HRLGTMEIESALVSHELISEAAVVGRPDDLKGESIVAFVTLRTGAEANENIEAQLKKHVV
NEIGPIAKPDEFKFTDSLPKTRSGKIMRRILRALASGDEISGDTSTLEDRSVLDKLRS
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaaacaattctaactctattgagtctgttctacaggagcagagagttttcccc
ccttctgataacttttccagtaaaagtaggatctcatctttttcaaagtatttggaaatg
tctgagatggccaaatcagatccaaataagttttggggtgacgctgctagagaagaattg
cactggtttaaatcttttaataaagtactcgattggtccaatccaccattcgctaaatgg
tttgatggaggaaaaactaatatttcctttaactgcttagatcgtcacttaaatagttca
acggctgacaaagtcgccttgatttgggaaggtgagccaggtgataagaaaaaatatacc
tacaaacaactacacaaagaagtatgcaaagccgccaatgcactcaagtctataggtata
ggtaaaggagatcttgtcgctttgtatatgcctatggttcccgaagctgcaattgcaatg
cttgcatgtgcaaggattggagctccgcattcagtagtatttggaggcttttcctctgag
gcactaagggaccgattaattaatggagaagcgaaagcaataattacagctgatggtggt
tttagaaaagataaagtaattcctctcaaagatgctgttgatcaagcattgggaggtggt
gcttgtccaaaggtcgaatcagttttagttgttcaaaggacaaaaaaaaatatcgccatg
gatgatggtagagattattggtggcatgaaattgtagacagtcaagcagatgattgtttg
ccggaacaaatggatagtgaggattgtttatttgttttgtatacctcaggctctacaggc
aaaccaaagggagtagttcattcaacagctgggtataacctttggtctcatttaactttt
aaatggatttttgatattcgtgaaaatgatgtttattggtgcacggctgatgtgggttgg
ataaccggacatagttatatcgtctatggtccactatctaatggtgcaaccactgttatg
tatgaaggagttcctagaccatcaaatccaggagctttttgggatgtcattcagaagcat
aaaatttcgattttttacactgctccaactgctataagggcttttatgaaagcgggtaac
aagattcctaaccaatatgatttatctagtttgaggcttttaggaactgttggagagcct
attaatccagaggcttggatatggtatcgggatgttattggaggaggtcgatgcccgata
gttgatacatggtggcaaacagaaactggaggagtgatgattagtcctctccctggggcg
acgccaacgaaacctggatcagcaactttccctttacccggaattgaagccgatgtagtc
aattcagatggggattctgtcgctaataatgagggtggatatttggtagtgaaaagacct
tggcctggaatgatgaggaatgtttatggagacgaaaaaagatttagagagagttactgg
gagtatttaaaaccttcagacaatagctatatgtattttgctggagatggggctcgaaga
gatgaagatggttatttttgggttatggggagagttgatgatgttataaacgtctctggt
cataggcttggaacaatggaaatagaatcagctttagttagtcatgagctcatttcagag
gccgcagttgtgggtagacctgatgatttaaaaggagaatcaatcgtagcctttgtaacc
ttgagaactggcgcagaagcaaatgaaaatattgaggcacaattaaaaaaacacgtcgtg
aatgaaataggccctattgctaaacctgatgaatttaagtttactgattctcttcctaaa
acaagaagtggaaaaataatgcgcagaattttgagagcactggcttcaggagatgaaata
agcggagatacaagtacccttgaggatagatcagttttagataaattaagaagttaa

DBGET integrated database retrieval system