KEGG   Prochlorococcus marinus NATL2A: PMN2A_0196Help
Entry
PMN2A_0196        CDS       T00267                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmn01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pmn00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(749113..750195)
Genome map
AA seq 360 aa AA seqDB search
MTTWVIKIGTSLLRGNDKYTTFDVINDYCSYISKAQRNGDKIILVSSGAVGLGCHQMRFK
TRPKEIISLQASAAIGQLHLMALYEKAMSSFGYKVAQILLTRSELGSRNSYNSASQTLKR
LLEWDVIPIVNENDITSDEELKYGDNDTLSALVATAISADQLILLTDIDHLYSSDPKINS
KAKPIKDINNSKELNNLELANEQTSWGTGGIKTKLTAAKIATESGIKVQLADGRDPKILG
ELLDGKKIGTVFHPNPNPIGNRKSWLAHAIKPVGEIHLDDGASEAIKNKGASLLLVGVKK
VSGDFIANQPVKVINTEGEEFAKGICSMSSDAIKIGINSRSETTGSPLVIHRDVLVLTSE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctgggtaataaagattggcacaagccttttgagaggaaacgataaatataca
acttttgatgtaattaacgattattgttcttatatatcaaaagctcaaaggaatggcgat
aaaattatattggtttctagtggtgctgtaggacttggatgtcatcaaatgagattcaag
acaagacctaaagaaataatctctcttcaagcttctgctgcaataggtcaacttcattta
atggctttgtatgaaaaggctatgagcagttttggatataaagttgcgcaaatattatta
actaggtcagaattaggatcaagaaatagttataattctgcttcgcaaacattaaaaagg
ttgctcgaatgggatgttataccaatcgtaaacgaaaatgatataacctcagatgaagag
ctaaagtatggtgataatgatactttatctgcattagttgcaacagctatatctgctgat
caattaatattattaactgatatcgatcatctctactcttctgatcccaaaatcaatagt
aaagctaagccaatcaaagatattaacaattcaaaagaattaaataatttagaactagca
aatgaacaaacttcatgggggactggaggaataaaaacaaaattaactgctgcaaagatc
gccactgaaagcgggataaaagttcaattagcagatggcagagatccgaaaatattaggc
gaattacttgatggaaaaaaaataggaactgtttttcaccccaatccaaaccctatcggg
aatagaaaaagttggttggcacatgcaattaaaccagtcggagaaatacacttagatgat
ggtgctagtgaagctatcaaaaacaaaggtgcttcactattattagttggggtaaaaaaa
gttagtggagattttattgctaatcaacctgtaaaagttattaacacggaaggagaggaa
tttgctaagggaatttgctcaatgagcagtgatgctataaagataggaattaattcaaga
tccgaaacaacaggatctcctctagttatccaccgagatgttctggttctaacaagtgaa
taa

DBGET integrated database retrieval system