KEGG   Prochlorococcus marinus NATL2A: PMN2A_0246Help
Entry
PMN2A_0246        CDS       T00267                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PMN2A_0246
Enzymes [BR:pmn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     PMN2A_0246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
791583..793334
Genome map
AA seq 583 aa AA seqDB search
MSELDSELDELRLSLREIYPGHSEQEINSVWSQLLQILDPFCVNKGKDELEIESIWDSSS
VVLITYPDSIYRKDESTLKTLTEFVKNRLGGLSSVIHVLPFLPSTSDGGFAVSNHEKIDD
SFGNWNDLKDLSGKHKIMADLVLNHVSSSHPWVHQFIKSEDSGPSYIVSPSETNVWENVI
RPRNTSLFTNINTKQGFKSVWTTFGPDQIDVDWRNPNIFLEFLKLLVRYITNGADWIRLD
AIAFIWKEPHTTCLHLDPVHSIVKLLNKCLKIIKPSAVLITETNVPEKENLSYLIEGNEA
NLAYNFTLPPLLLEAIYTGKTDLLKSWLSTWKELPRHTSLLNFTSSHDGIGLRALEGIMD
DQRIHNLLVESEKRGGLVSHRRLSNGDDQPYELNISWWSAMSNEGSDNTVFQFERFLLSQ
LFTLSIKGVPAFYLPSVLASPNDIDSFRKTGQRRDLNREKFEANQLLDVLKNFDSPASKN
ISYLTHIVKVRSRLKAFHPEASMKCISTNIANCIILQRGLDEDSVYVICNMSSNFLCISP
LNQINSLELTPEKRLLDNITGSYFNTDTFKLNPYQVVWLTLDD
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgagttggatagtgaattagatgagctgagattatctctcagagaaatttatcct
gggcactctgaacaagaaatcaattcagtgtggtcgcaattgttgcagattcttgatcca
ttttgtgttaacaagggcaaagatgaattagagatcgaatcaatttgggattcttcaagt
gttgttttgattacttaccctgattcaatttataggaaggatgaatcaactttaaaaaca
ttaactgaattcgtaaaaaatagattaggtggcctttcatcagtcatacatgttttacca
tttcttccttctacaagtgatggaggattcgctgtttctaatcatgaaaaaatcgatgat
tcctttgggaattggaatgatttaaaggatttatctggtaagcataaaataatggcagat
ctagttttaaatcatgtctcttcttctcatccatgggttcatcaatttataaaatcagag
gattcaggtccgtcttacattgtttctccttctgagactaatgtttgggaaaatgtgata
aggcccagaaatacatcactctttaccaatatcaatactaaacaaggctttaagagtgtt
tggacaacctttggaccagatcagattgatgttgattggaggaatccaaatatcttttta
gagtttttgaaattattggttagatacataactaatggagctgactggattcgacttgat
gcaattgcatttatttggaaggagccgcatactacttgtttacatttagacccagtacac
tcaatagttaagctgttaaataaatgtttgaagattataaaaccttcggcagtattaatt
accgagactaatgttccagagaaagaaaacctttcttatttgattgaaggaaatgaagct
aatcttgcttataactttactctacctcctttattattagaagctatttataccggtaaa
acagatttattgaagagttggttgtcaacgtggaaagagttgccaaggcacacttctttg
ctcaacttcacttcttcacacgatggtattggattacgagcactagaaggcattatggac
gatcagagaatacataatctcttggttgaatcagagaaacgaggaggattagttagtcat
cgtcgcttgtcaaatggagatgatcaaccttatgaattaaacattagttggtggagtgcg
atgtcaaacgaaggctccgataatacggtatttcaatttgagcgttttttattaagtcag
ctttttactttatccataaaaggtgttccagctttttatcttccatctgtattagcttct
ccgaatgatatagattcttttaggaaaacagggcaaagaagagatttaaatcgagaaaaa
tttgaagctaaccaattacttgatgtacttaagaactttgattctcccgctagtaaaaat
atttcatacctcactcatatagttaaagtcaggtcaagacttaaagcttttcatccggag
gcgagtatgaaatgtatctctacgaatatagctaattgtataattcttcaaagaggcttg
gatgaagatagtgtctatgttatttgtaatatgtctagtaatttcttatgtatttctcca
ttaaatcaaattaattcattagaattaacccctgagaaacgtttactagataatattaca
ggttcttatttcaatactgatacttttaaacttaatccttatcaagtcgtttggcttaca
ttagatgattag

DBGET integrated database retrieval system