KEGG   Prochlorococcus marinus NATL2A: PMN2A_0279Help
Entry
PMN2A_0279        CDS       T00267                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PMN2A_0279
Enzymes [BR:pmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PMN2A_0279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
820522..821481
Genome map
AA seq 319 aa AA seqDB search
MVPSKANEDFLIANAHAKINLHLEVLGIRSDGFHELAMVMQSINLSDQLKMIKRVDNTIN
LKSNNKEISNGDDNLIIKAAKLLRNKVENQELGVDIELEKNIPIGAGLAGGSTDAAATLL
GLNKLWKLNLKIDELENLSKEIGSDIPFCISGGRQICFGRGEILEKLKFDQIQLGLVLVK
DPSIQVSTPVAYKKYKEQFGESYLEDDRDFEIKRNSIRSIDWSDQSLFDNRKEIQNDLQK
SIRPMTPEVEKSLNLLSSLPDSRLVSMSGSGPSCFALFQNYDQANKVLKEHVNEFERAGL
SAWACSMMSNGVELRNEFT
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggtaccttccaaagcaaatgaagattttcttatcgcaaatgcacatgcaaaaattaat
ctacatttagaggttttaggtattaggagcgatggctttcatgaattagcaatggtcatg
caaagtattaatttaagtgatcaattgaaaatgataaaaagagtagataatactattaat
ctaaaatctaataataaagaaattagtaatggtgacgataatctaataataaaagctgca
aagctgttgagaaataaagtagaaaatcaagaattaggtgttgatattgaacttgagaaa
aacatacctattggggcaggattggcagggggatctacagatgcagctgcaacattactt
ggattaaataaactctggaagctaaatcttaagattgatgaattagagaacctatcaaaa
gaaataggatcagatatccctttttgcatatcaggagggaggcaaatatgttttggtaga
ggtgaaattttagaaaaattgaaatttgatcaaattcagttaggtcttgttttagttaaa
gacccttcaatacaagtatctactccagttgcatacaaaaaatataaagagcagtttggt
gaaagctatcttgaagatgatagggattttgaaatcaaaagaaactctattagatctatt
gactggtctgatcagtcgctttttgataatcgtaaagaaatacaaaatgatttacaaaaa
agcattcgccctatgacaccagaggttgagaagtcattgaatttattatctagtttgcca
gattcacgtcttgtttcaatgagtggttctggtccaagttgttttgccttgtttcaaaat
tatgaccaagcaaataaagtactcaaagaacatgttaacgaatttgaaagggctggttta
tcagcttgggcatgttcaatgatgtctaatggagttgaattaagaaatgaattcacctag

DBGET integrated database retrieval system