KEGG   Prochlorococcus marinus NATL2A: PMN2A_0382Help
Entry
PMN2A_0382        CDS       T00267                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:pmn01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmn01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pmn00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pmn00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:pmn00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:pmn00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(929684..930424)
Genome map
AA seq 246 aa AA seqDB search
MRKPVIAGNWKMNMTCTEAIEYMRVLIPLLKDIPKKDREIVIAPPFTALYPLSEFIRDRN
EYLSLSSQNVHWEDSGAYTAEVSPLMLNELSVKCAIVGHSEPRKYFSESDEQINKRAKSA
QDHQLIPIVCVGETFQQREMGEAERVIRRQIEQGLEGIEVKRLIVAYEPIWAIGTGKTCE
ANEANRICGLIRKWIGYEDVIIQYGGSVKSNNIDEIMSMSDIDGVLVGGASLDPTNFARI
ANYEKI
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaaaccggtcattgcagggaattggaagatgaacatgacatgtaccgaagcgatt
gagtacatgcgtgtattaattccactactgaaagatattccgaaaaaagatagggaaatt
gttattgcccccccatttacagccctataccctctgtctgagtttattagggacagaaat
gaatatctatcgttatctagccaaaatgttcattgggaggatagtggggcctatacggca
gaagtttctcccctaatgcttaatgagctttcggttaagtgtgcaatcgttggacacagt
gaacctcgtaaatattttagtgaaagtgatgaacaaattaataaaagagcaaaatccgct
caagatcatcagttaattccaattgtttgtgttggagaaacttttcaacaaagagaaatg
ggtgaagcagaaagggttatacgaaggcaaattgaacaaggtcttgaaggaattgaagta
aaaagactaatagttgcttatgaaccaatctgggctattggaactggtaaaacttgtgaa
gccaatgaggctaatcgaatttgtggacttattcgtaagtggattggctacgaagatgtg
attattcaatatggtggatcagtaaaatcaaataatattgatgaaatcatgtccatgtca
gatattgatggtgtactagttggaggagcatctctagatcctacaaattttgccagaatt
gctaactacgaaaaaatctaa

DBGET integrated database retrieval system