KEGG   Prochlorococcus marinus NATL2A: PMN2A_0382Help
Entry
PMN2A_0382        CDS       T00267                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn00010  Glycolysis / Gluconeogenesis
pmn00051  Fructose and mannose metabolism
pmn00562  Inositol phosphate metabolism
pmn00710  Carbon fixation in photosynthetic organisms
pmn01100  Metabolic pathways
pmn01110  Biosynthesis of secondary metabolites
pmn01120  Microbial metabolism in diverse environments
pmn01130  Biosynthesis of antibiotics
pmn01200  Carbon metabolism
pmn01230  Biosynthesis of amino acids
Module
pmn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMN2A_0382
   00051 Fructose and mannose metabolism
    PMN2A_0382
   00562 Inositol phosphate metabolism
    PMN2A_0382
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PMN2A_0382
Enzymes [BR:pmn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PMN2A_0382
Exosome [BR:pmn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PMN2A_0382
  Exosomal proteins of bladder cancer cells
   PMN2A_0382
  Exosomal proteins of melanoma cells
   PMN2A_0382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AAZ57874
CYORF: PMN2A_0382
UniProt: Q46KV4
Position
complement(929684..930424)
Genome map
AA seq 246 aa AA seqDB search
MRKPVIAGNWKMNMTCTEAIEYMRVLIPLLKDIPKKDREIVIAPPFTALYPLSEFIRDRN
EYLSLSSQNVHWEDSGAYTAEVSPLMLNELSVKCAIVGHSEPRKYFSESDEQINKRAKSA
QDHQLIPIVCVGETFQQREMGEAERVIRRQIEQGLEGIEVKRLIVAYEPIWAIGTGKTCE
ANEANRICGLIRKWIGYEDVIIQYGGSVKSNNIDEIMSMSDIDGVLVGGASLDPTNFARI
ANYEKI
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaaaccggtcattgcagggaattggaagatgaacatgacatgtaccgaagcgatt
gagtacatgcgtgtattaattccactactgaaagatattccgaaaaaagatagggaaatt
gttattgcccccccatttacagccctataccctctgtctgagtttattagggacagaaat
gaatatctatcgttatctagccaaaatgttcattgggaggatagtggggcctatacggca
gaagtttctcccctaatgcttaatgagctttcggttaagtgtgcaatcgttggacacagt
gaacctcgtaaatattttagtgaaagtgatgaacaaattaataaaagagcaaaatccgct
caagatcatcagttaattccaattgtttgtgttggagaaacttttcaacaaagagaaatg
ggtgaagcagaaagggttatacgaaggcaaattgaacaaggtcttgaaggaattgaagta
aaaagactaatagttgcttatgaaccaatctgggctattggaactggtaaaacttgtgaa
gccaatgaggctaatcgaatttgtggacttattcgtaagtggattggctacgaagatgtg
attattcaatatggtggatcagtaaaatcaaataatattgatgaaatcatgtccatgtca
gatattgatggtgtactagttggaggagcatctctagatcctacaaattttgccagaatt
gctaactacgaaaaaatctaa

DBGET integrated database retrieval system