KEGG   Prochlorococcus marinus NATL2A: PMN2A_0382Help
Entry
PMN2A_0382        CDS       T00267                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PMN2A_0382 (tpiA)
   01230 Biosynthesis of amino acids
    PMN2A_0382 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMN2A_0382 (tpiA)
   00051 Fructose and mannose metabolism
    PMN2A_0382 (tpiA)
   00562 Inositol phosphate metabolism
    PMN2A_0382 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PMN2A_0382 (tpiA)
Enzymes [BR:pmn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PMN2A_0382 (tpiA)
Exosome [BR:pmn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PMN2A_0382 (tpiA)
  Exosomal proteins of bladder cancer cells
   PMN2A_0382 (tpiA)
  Exosomal proteins of melanoma cells
   PMN2A_0382 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(929684..930424)
Genome map
AA seq 246 aa AA seqDB search
MRKPVIAGNWKMNMTCTEAIEYMRVLIPLLKDIPKKDREIVIAPPFTALYPLSEFIRDRN
EYLSLSSQNVHWEDSGAYTAEVSPLMLNELSVKCAIVGHSEPRKYFSESDEQINKRAKSA
QDHQLIPIVCVGETFQQREMGEAERVIRRQIEQGLEGIEVKRLIVAYEPIWAIGTGKTCE
ANEANRICGLIRKWIGYEDVIIQYGGSVKSNNIDEIMSMSDIDGVLVGGASLDPTNFARI
ANYEKI
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaaaccggtcattgcagggaattggaagatgaacatgacatgtaccgaagcgatt
gagtacatgcgtgtattaattccactactgaaagatattccgaaaaaagatagggaaatt
gttattgcccccccatttacagccctataccctctgtctgagtttattagggacagaaat
gaatatctatcgttatctagccaaaatgttcattgggaggatagtggggcctatacggca
gaagtttctcccctaatgcttaatgagctttcggttaagtgtgcaatcgttggacacagt
gaacctcgtaaatattttagtgaaagtgatgaacaaattaataaaagagcaaaatccgct
caagatcatcagttaattccaattgtttgtgttggagaaacttttcaacaaagagaaatg
ggtgaagcagaaagggttatacgaaggcaaattgaacaaggtcttgaaggaattgaagta
aaaagactaatagttgcttatgaaccaatctgggctattggaactggtaaaacttgtgaa
gccaatgaggctaatcgaatttgtggacttattcgtaagtggattggctacgaagatgtg
attattcaatatggtggatcagtaaaatcaaataatattgatgaaatcatgtccatgtca
gatattgatggtgtactagttggaggagcatctctagatcctacaaattttgccagaatt
gctaactacgaaaaaatctaa

DBGET integrated database retrieval system