KEGG   Prochlorococcus marinus NATL2A: PMN2A_0646Help
Entry
PMN2A_0646        CDS       T00267                                 

Definition
DNA helicase/exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PMN2A_0646
Enzymes [BR:pmn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PMN2A_0646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1136437..1138158
Genome map
AA seq 573 aa AA seqDB search
MRYSLEKIFSTDLNKALLATLIRYYPPIESNEALIDIVNVLMDGLSRGDVYIDMKKIPEN
LELKYKDWPSYHMKALLESGWTKGDNSPIVLNGDLISWRRTHNEIVETIQKILLRNQPIN
HLSKELPVRIEAKNLEHLNIQQIDAVNLVKSEQIILLSGGPGTGKTSTILQMLLEALTRN
PTLSIAMAAPTGKAAKKLKDTIQAGIEDFDDPIKDKLSNIPSKTLHKWLEAGPNGFRRNS
QRLLKLDLIVIDEMSMVDLSTINGLLDALTKSCQIILVGDPDQLLPIGSGGIWQILQEKE
TKTNFQSNSVKLTKSYRNKGDIALLRNILKDKGVDAFWQLLSKKEDSTNTLHYLSSIKSI
PDPVVRTLVSYRKKLKELTENCINYIPDEAWQSSMIEVDQSVEIQKLFKFIDNLLILCPQ
RYGPWGVKKIHEFLLGKRFEKEVHKWGEATPIMAKSNQPEIGLANGDVGVIIGNGEKRRF
LFNVFSEEQRLVTRLINPSRLNRYDAAYAMTIHKAQGSEADQVLLLWPTTSKVSEEKTSN
KFYSDDYEKRMLYTAITRAKKQLMVITNKEEDF
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgagatattccttggaaaaaattttttcaactgatttaaataaagcattattagctacc
ctaattcgctattacccacccatagagtctaatgaagctttaatagatattgtaaatgta
ttaatggatggattatcaagaggcgatgtttacatagacatgaagaaaatccctgaaaat
cttgaacttaaatataaagattggcccagctatcatatgaaagcattattagagagtggc
tggactaaaggagataactccccaatagttttaaatggagatttgattagttggcggcgt
acacataatgagatagttgagaccattcaaaaaatattattaaggaatcaacctattaat
cacctatctaaagaattacctgttcgaattgaagctaagaatctagagcatctaaatatt
caacaaatagatgctgttaaccttgttaagagtgaacaaatcatcttattaagtggtggc
ccaggcacaggcaagactagtaccatacttcaaatgcttttagaagcactaacaagaaat
ccaactcttagtattgcaatggctgctccaacagggaaagccgcaaaaaaactaaaagat
actattcaggcaggaattgaagattttgatgatcctataaaggataagctttctaacatt
ccttctaaaacattacataaatggttagaagcaggaccaaatggcttcagaagaaactct
caacgtctattaaaattagacctaatagtcatagatgagatgtcaatggttgatttatca
accattaatggtttgctcgatgcattaacaaaatcatgtcaaataatattagtaggtgat
cctgaccaattattaccaataggaagtggtggcatatggcaaattttgcaagagaaagaa
actaaaacaaactttcaatctaactcagtcaaactaacaaagtcataccgaaataaagga
gatatcgctttattaagaaatatactaaaagataaaggagtagacgccttttggcagctg
ctttcaaagaaagaagattcaacaaatacacttcattacctttcatccataaaaagtatt
ccagatcctgtcgtaaggactcttgtaagctatagaaagaagcttaaagaattaacagaa
aattgtatcaattatattccagatgaagcctggcaatcaagcatgattgaggtagatcaa
tcagttgagatacaaaaactctttaaattcatagataatcttcttatactttgtccgcaa
agatatgggccttggggtgtaaaaaaaatccacgagttccttttaggaaagagatttgag
aaggaagtacataagtggggggaggcaacaccaataatggcaaaaagtaatcaacctgaa
ataggtttagcgaatggagacgttggggtaattattggcaacggtgagaaaagacgtttt
ttatttaatgttttttctgaggaacaaaggctagtaactcgactaataaacccatcaagg
ttaaatagatatgatgcggcatatgcaatgacaattcataaagcacaagggagtgaagct
gatcaagttcttttactttggccaacgacctcaaaagtttcagaagagaagacttccaat
aaattttattctgatgattatgaaaaaagaatgctttacacagcaataactcgcgcaaaa
aaacaattaatggtaattaccaataaagaagaagacttttaa

DBGET integrated database retrieval system