KEGG   Prochlorococcus marinus NATL2A: PMN2A_0646Help
Entry
PMN2A_0646        CDS       T00267                                 

Definition
(GenBank) DNA helicase/exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PMN2A_0646
Enzymes [BR:pmn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PMN2A_0646
DNA repair and recombination proteins [BR:pmn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PMN2A_0646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 UvrD_C Viral_helicase1 DUF2075 UvrD-helicase PhoH AAA_22 Helicase_RecD PIF1 AAA_12 IstB_IS21 AAA_16 ATPase Terminase_1 AAA T2SSE TrwB_AAD_bind AAA_25 ResIII AAA_5 DEAD
Motif
Other DBs
NCBI-ProteinID: AAZ58137
CYORF: PMN2A_0646
UniProt: Q46K41
Position
1136437..1138158
Genome map
AA seq 573 aa AA seqDB search
MRYSLEKIFSTDLNKALLATLIRYYPPIESNEALIDIVNVLMDGLSRGDVYIDMKKIPEN
LELKYKDWPSYHMKALLESGWTKGDNSPIVLNGDLISWRRTHNEIVETIQKILLRNQPIN
HLSKELPVRIEAKNLEHLNIQQIDAVNLVKSEQIILLSGGPGTGKTSTILQMLLEALTRN
PTLSIAMAAPTGKAAKKLKDTIQAGIEDFDDPIKDKLSNIPSKTLHKWLEAGPNGFRRNS
QRLLKLDLIVIDEMSMVDLSTINGLLDALTKSCQIILVGDPDQLLPIGSGGIWQILQEKE
TKTNFQSNSVKLTKSYRNKGDIALLRNILKDKGVDAFWQLLSKKEDSTNTLHYLSSIKSI
PDPVVRTLVSYRKKLKELTENCINYIPDEAWQSSMIEVDQSVEIQKLFKFIDNLLILCPQ
RYGPWGVKKIHEFLLGKRFEKEVHKWGEATPIMAKSNQPEIGLANGDVGVIIGNGEKRRF
LFNVFSEEQRLVTRLINPSRLNRYDAAYAMTIHKAQGSEADQVLLLWPTTSKVSEEKTSN
KFYSDDYEKRMLYTAITRAKKQLMVITNKEEDF
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgagatattccttggaaaaaattttttcaactgatttaaataaagcattattagctacc
ctaattcgctattacccacccatagagtctaatgaagctttaatagatattgtaaatgta
ttaatggatggattatcaagaggcgatgtttacatagacatgaagaaaatccctgaaaat
cttgaacttaaatataaagattggcccagctatcatatgaaagcattattagagagtggc
tggactaaaggagataactccccaatagttttaaatggagatttgattagttggcggcgt
acacataatgagatagttgagaccattcaaaaaatattattaaggaatcaacctattaat
cacctatctaaagaattacctgttcgaattgaagctaagaatctagagcatctaaatatt
caacaaatagatgctgttaaccttgttaagagtgaacaaatcatcttattaagtggtggc
ccaggcacaggcaagactagtaccatacttcaaatgcttttagaagcactaacaagaaat
ccaactcttagtattgcaatggctgctccaacagggaaagccgcaaaaaaactaaaagat
actattcaggcaggaattgaagattttgatgatcctataaaggataagctttctaacatt
ccttctaaaacattacataaatggttagaagcaggaccaaatggcttcagaagaaactct
caacgtctattaaaattagacctaatagtcatagatgagatgtcaatggttgatttatca
accattaatggtttgctcgatgcattaacaaaatcatgtcaaataatattagtaggtgat
cctgaccaattattaccaataggaagtggtggcatatggcaaattttgcaagagaaagaa
actaaaacaaactttcaatctaactcagtcaaactaacaaagtcataccgaaataaagga
gatatcgctttattaagaaatatactaaaagataaaggagtagacgccttttggcagctg
ctttcaaagaaagaagattcaacaaatacacttcattacctttcatccataaaaagtatt
ccagatcctgtcgtaaggactcttgtaagctatagaaagaagcttaaagaattaacagaa
aattgtatcaattatattccagatgaagcctggcaatcaagcatgattgaggtagatcaa
tcagttgagatacaaaaactctttaaattcatagataatcttcttatactttgtccgcaa
agatatgggccttggggtgtaaaaaaaatccacgagttccttttaggaaagagatttgag
aaggaagtacataagtggggggaggcaacaccaataatggcaaaaagtaatcaacctgaa
ataggtttagcgaatggagacgttggggtaattattggcaacggtgagaaaagacgtttt
ttatttaatgttttttctgaggaacaaaggctagtaactcgactaataaacccatcaagg
ttaaatagatatgatgcggcatatgcaatgacaattcataaagcacaagggagtgaagct
gatcaagttcttttactttggccaacgacctcaaaagtttcagaagagaagacttccaat
aaattttattctgatgattatgaaaaaagaatgctttacacagcaataactcgcgcaaaa
aaacaattaatggtaattaccaataaagaagaagacttttaa

DBGET integrated database retrieval system