KEGG   Prochlorococcus marinus NATL2A: PMN2A_0669Help
Entry
PMN2A_0669        CDS       T00267                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PMN2A_0669
Enzymes [BR:pmn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PMN2A_0669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1161290..1162786)
Genome map
AA seq 498 aa AA seqDB search
MKLERNSGILLHPTSLPDSPVCGSFGKPAREWLNELAAFGIGVWQFLPLAPTDSLGSPYS
SPSSFALNPWFLDQNDLVRDGFLANNLEDFSSANDCFKNRVDFHLANSKVKSLRFSLVDD
WYKQNRTIQEEFEIWCSKQFWLDDHSIFMELKIQNNDLPWWEWPEEYACRDKKELENWKK
NNQKELLGHKLLQWHLDRQWQSIRELAKNLGIYLFGDVPFYVSKDSADVWGNRSLFSILT
NSDTFLQSGVPPDYFSETGQLWGNPVYRWSRHKASRYRWWRKRISRHLEQVDFLRLDHFR
ALEAFWAIPGKDKTAENGLWLPSPGKQILSLIKKDCCGSLPLIAEDLGLVTSKVEKLRDD
YELAGMKILQFAFDGNLDNPYLPENIKEENWIVYTGTHDNSTSLGWWREMDQGRKEQLRE
RIFDYENFTSWELIRIGMETKAKLFVAPMQDLLNLDDSCRLNKPGTTENNWSWRLPRNDL
NIRDALKKYGDLAKANKR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattggaaagaaattcaggaatcctgcttcatccaacctcattacctgatagtcct
gtttgcggaagtttcggtaaacctgctcgagaatggcttaatgaacttgctgcctttgga
ataggtgtgtggcaatttttacctcttgctcctactgattcacttggatctccatatagc
tctccatcaagttttgctttgaacccatggttccttgaccaaaatgatttagtgagggac
ggattcttagctaataacctggaagatttttcttctgcaaatgattgttttaaaaataga
gttgattttcatttagcaaattcaaaagttaagtccttacgtttttctttggttgatgat
tggtataaacagaatagaactattcaagaagaatttgaaatatggtgctcaaaacaattt
tggttagatgatcattccatatttatggaacttaagattcaaaacaatgatcttccatgg
tgggaatggccagaagaatatgcatgtagggataagaaagaattagaaaattggaaaaaa
aataaccaaaaagaattattaggccataaacttctccagtggcatttagacaggcagtgg
caatcaatcagagagcttgcgaaaaatctaggaatttatttatttggagatgtccctttt
tatgtatcaaaagatagtgctgatgtttgggggaatcggtcattattttctattttgact
aattcagatacattccttcaaagtggagtcccacctgattatttttctgaaaccggtcag
ctctggggtaaccctgtttatcgctggagtaggcacaaagcaagtagatatagatggtgg
agaaaaagaatttcaagacatctagaacaggttgattttttacgccttgatcattttcgt
gccctcgaagctttttgggcaattcccggcaaagataaaacagcagagaatggactttgg
ttgccctctccaggaaaacagatactaagtttaatcaaaaaagattgctgcggctctctt
ccattaattgctgaagacttaggtctcgtaacctcaaaagtagagaagttacgcgatgat
tatgaattagcaggaatgaagatacttcaattcgcttttgatgggaatttggataatccg
tatttgccagagaatattaaagaagaaaattggattgtttatacaggaactcacgacaat
tcaacttctcttggatggtggagagaaatggatcaaggtagaaaagaacaacttagagaa
aggatttttgattatgagaatttcacttcttgggaattgattcgaataggcatggaaact
aaagccaaattatttgtagcacctatgcaagatttgttaaatcttgatgatagctgtcgt
ttaaataaacctggcacaacagaaaataattggtcatggagattaccgagaaatgattta
aatattagagatgctttgaaaaaatatggtgatttagctaaagcaaataaaagataa

DBGET integrated database retrieval system