KEGG   Prochlorococcus marinus NATL2A: PMN2A_0709Help
Entry
PMN2A_0709        CDS       T00267                                 

Definition
pfkB family carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PMN2A_0709
Enzymes [BR:pmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PMN2A_0709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1205730..1206572
Genome map
AA seq 280 aa AA seqDB search
MRIDAPKEILSLPNLKLAVIGHVEWVTFLKVDQLPLAGQISHAKDCFEEAAGGAAVAAVQ
MARLINNPVDLITSLGKDNYGEKCYERLTKLGLNLKVAWREKPTRKGISLISKDGERAIT
VIGERLQPIGSDNLPWSDLKNYDGVFVTATDKEGIRFARKARFLSATPRTGQQTLKNSKV
KLNALIGSGLDPGEKINYEELEPKPDIYISTKGESGGTIFPENIKYKPITPSSEEIDTYG
CGDSFAGAVTTALSAKLNLEQAINIGAYCGAECSTHYGPY
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgatgctcctaaagaaatacttagccttcctaaccttaaattagcggtgatc
ggtcatgttgaatgggtaacattcttaaaggttgatcagctcccattagcgggacaaatt
tcgcatgcaaaagattgctttgaagaagcagcaggtggtgcggcagtcgcagctgttcag
atggcaaggctaataaataaccctgttgacttaatcacatcattgggcaaagacaattat
ggtgaaaaatgctacgaaagactcactaaacttggtttaaatttaaaagtagcttggcgt
gagaaaccaactagaaaagggattagcctaatcagcaaagatggagaaagagcaattaca
gttattggagaaagattacagccaatcggttctgataatttaccttggagtgatttgaaa
aattacgatggtgtttttgttaccgctactgacaaagaaggaataagattcgctaggaaa
gctagattcctctctgcgactccccgaacaggtcaacaaaccctaaagaattcaaaagta
aaactcaatgcattgattgggagtggtcttgatcctggtgaaaagataaattacgaagag
cttgaacctaaaccagacatatacatttcaacaaaaggtgaatcaggtggaacaattttt
cccgaaaatattaaatacaaacccattactcctagttctgaagaaatagatacctatggt
tgtggggacagtttcgcgggagctgtgactactgccctctcagcaaagctaaatttagag
caagcgattaatataggtgcatattgcggtgctgaatgctcaactcattacgggccttac
taa

DBGET integrated database retrieval system