KEGG   Prochlorococcus marinus NATL2A: PMN2A_0751Help
Entry
PMN2A_0751        CDS       T00267                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn00900  Terpenoid backbone biosynthesis
pmn01100  Metabolic pathways
pmn01110  Biosynthesis of secondary metabolites
pmn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PMN2A_0751
Enzymes [BR:pmn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PMN2A_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AAZ58242
CYORF: PMN2A_0751
UniProt: Q46JT6
Position
1262828..1264066
Genome map
AA seq 412 aa AA seqDB search
MKAISVLGSTGSIGTQTLQIAEEFPEQFKIVALTAGKNLDLVIKQIETHQPEVVSLADES
LLSELSSRINSLTENKKIVKKPLLMAGAEGLNTAAAWGSADLVVTGIVGCAGLLPTLAAI
EAGKDLALANKETLIAAGPVVIPALKKSGSRLLPADSEHSAIFQCLQGTPWADNARLSTG
MPTPGFKSIQLTASGGAFRDWKAEDLVKATVEDATSHPNWSMGKKITVDSATLMNKGLEV
IEAHYLFGLSYDQIEIIIHPQSIIHSMVELDDSSVLAQLGWPDMKLPILYCLSWPSRLKT
PWPRLKLTQIGNLTFKEPDTKKYPCMELAYSAGKSGGTMPAVLNAANEKAVELFLEERFK
FIDIPKVIEAICEKHKCDLNLNPSLSEILEIDNWAREEVLDYSEKNITKMQF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagccataagcgttttaggctcaacaggatctattggaactcaaacccttcaaatt
gcagaagagtttcctgagcaattcaaaattgttgctctaacagcaggaaagaatcttgat
ttagtaatcaaacaaattgaaactcatcaacctgaagttgtttcactagcagatgaatcg
cttttatcagaactttcttctcgaattaatagtctcactgaaaataaaaaaatagtcaaa
aagcccttattgatggcgggagccgaaggacttaatactgcagcagcttggggaagtgca
gatcttgttgtaactggaatagttggctgtgcaggcctcctaccaacacttgcagctatt
gaagcagggaaggacctagctctagcaaataaagaaactttgattgcagcaggaccagtt
gtaattccggctttaaaaaaaagcggcagtagactcttacctgcagattcagaacactca
gcgatatttcaatgtctccaaggaacgccatgggctgacaatgcaagactctcaactgga
atgcctactccaggatttaaatcaatacaattaactgcatcagggggagcctttagagat
tggaaagcagaagatttagtcaaagcaactgtcgaggatgcgactagccatcctaattgg
agcatgggaaagaaaataactgtagattctgcaaccctcatgaataagggactcgaagtc
attgaagcgcattatctttttggtctttcatatgaccaaatcgaaatcattatccatcca
caaagcatcattcactcgatggttgaattggatgattcatcagttttagctcaattggga
tggccagatatgaagctccctattttgtattgcttaagttggcctagtcgacttaaaacc
ccatggccaagattaaagcttactcaaataggcaatttaacttttaaagaaccagatact
aaaaaatatccatgtatggaacttgcttacagcgcaggaaaatcaggggggacaatgcca
gcagtgcttaatgcagctaatgaaaaagcagtagaactttttctagaagaaaggtttaaa
tttatcgatattccaaaagtaattgaggcgatttgcgagaaacataaatgcgacctaaat
ctaaatccaagcctcagtgaaattcttgaaattgacaactgggcaagagaagaagtctta
gattattcagaaaaaaatattacaaaaatgcagttttag

DBGET integrated database retrieval system