KEGG   Prochlorococcus marinus NATL2A: PMN2A_0751Help
Entry
PMN2A_0751        CDS       T00267                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pmn00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1262828..1264066
Genome map
AA seq 412 aa AA seqDB search
MKAISVLGSTGSIGTQTLQIAEEFPEQFKIVALTAGKNLDLVIKQIETHQPEVVSLADES
LLSELSSRINSLTENKKIVKKPLLMAGAEGLNTAAAWGSADLVVTGIVGCAGLLPTLAAI
EAGKDLALANKETLIAAGPVVIPALKKSGSRLLPADSEHSAIFQCLQGTPWADNARLSTG
MPTPGFKSIQLTASGGAFRDWKAEDLVKATVEDATSHPNWSMGKKITVDSATLMNKGLEV
IEAHYLFGLSYDQIEIIIHPQSIIHSMVELDDSSVLAQLGWPDMKLPILYCLSWPSRLKT
PWPRLKLTQIGNLTFKEPDTKKYPCMELAYSAGKSGGTMPAVLNAANEKAVELFLEERFK
FIDIPKVIEAICEKHKCDLNLNPSLSEILEIDNWAREEVLDYSEKNITKMQF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagccataagcgttttaggctcaacaggatctattggaactcaaacccttcaaatt
gcagaagagtttcctgagcaattcaaaattgttgctctaacagcaggaaagaatcttgat
ttagtaatcaaacaaattgaaactcatcaacctgaagttgtttcactagcagatgaatcg
cttttatcagaactttcttctcgaattaatagtctcactgaaaataaaaaaatagtcaaa
aagcccttattgatggcgggagccgaaggacttaatactgcagcagcttggggaagtgca
gatcttgttgtaactggaatagttggctgtgcaggcctcctaccaacacttgcagctatt
gaagcagggaaggacctagctctagcaaataaagaaactttgattgcagcaggaccagtt
gtaattccggctttaaaaaaaagcggcagtagactcttacctgcagattcagaacactca
gcgatatttcaatgtctccaaggaacgccatgggctgacaatgcaagactctcaactgga
atgcctactccaggatttaaatcaatacaattaactgcatcagggggagcctttagagat
tggaaagcagaagatttagtcaaagcaactgtcgaggatgcgactagccatcctaattgg
agcatgggaaagaaaataactgtagattctgcaaccctcatgaataagggactcgaagtc
attgaagcgcattatctttttggtctttcatatgaccaaatcgaaatcattatccatcca
caaagcatcattcactcgatggttgaattggatgattcatcagttttagctcaattggga
tggccagatatgaagctccctattttgtattgcttaagttggcctagtcgacttaaaacc
ccatggccaagattaaagcttactcaaataggcaatttaacttttaaagaaccagatact
aaaaaatatccatgtatggaacttgcttacagcgcaggaaaatcaggggggacaatgcca
gcagtgcttaatgcagctaatgaaaaagcagtagaactttttctagaagaaaggtttaaa
tttatcgatattccaaaagtaattgaggcgatttgcgagaaacataaatgcgacctaaat
ctaaatccaagcctcagtgaaattcttgaaattgacaactgggcaagagaagaagtctta
gattattcagaaaaaaatattacaaaaatgcagttttag

DBGET integrated database retrieval system