KEGG   Prochlorococcus marinus NATL2A: PMN2A_0811Help
Entry
PMN2A_0811        CDS       T00267                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PMN2A_0811
Enzymes [BR:pmn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     PMN2A_0811
Transfer RNA biogenesis [BR:pmn03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    PMN2A_0811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1314542..1315456)
Genome map
AA seq 304 aa AA seqDB search
MSIDLVVPKEVELPTLLDELRKLSWASADVLMAYARGGEPPYGFPKSLNVEEGGDGPVSA
ADMAVNELLISGLKDNLAFKEWDILSEETSKEKTFQQDNYKKDWCWILDPLDGTKDFLQG
SENYAVHIALAYKKKPKIGIVLIPEKNELWFGIVGIGAWFEDRDGSKNHFSFSDRLDISK
LILVSSKNHQQSKLNNLLSTLCFGETKKIGSVGCKVASILRGEADVYISLSGKTSPKDWD
MAAPHALIEAAGGMFSHADGKNLVYQEKNYSQSGCLIASHGKSHQKICQKAMDFFSLEEP
KYFV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgatcttgttgtgccaaaagaggtcgaattaccgactttattggatgagctt
agaaagcttagctgggcttccgctgatgttttgatggcatatgcaagaggtggtgaacct
ccatatggcttccctaaatcattaaatgtagaggaaggcggggatggcccagtatctgca
gctgacatggcagtgaatgaattattgatctctggattgaaggataatctcgctttcaaa
gaatgggatattttaagcgaagaaacttctaaggagaaaacttttcagcaagataattat
aaaaaagattggtgttggattcttgatccattagatgggacaaaggattttcttcaagga
tctgaaaactatgcagttcatattgctttggcgtacaaaaaaaagccaaaaatcgggata
gttttgatacctgaaaagaatgaattatggtttggaattgttgggattggtgcatggttt
gaagatcgtgatggctctaaaaaccacttttcttttagtgatagattggatatttcgaaa
ttgatactagtttcaagtaaaaatcatcaacaatcaaaacttaataaccttctgtcaact
ctgtgctttggtgagacaaaaaaaataggcagtgtcggttgtaaagttgcttcaatcttg
aggggagaagcagatgtttatatctctctatctggaaaaacttcacccaaggattgggat
atggctgctccacatgctcttattgaggcggctggtggtatgttctctcatgcagatgga
aaaaatttagtttaccaagaaaaaaactattctcaatctggttgtttaattgcaagccat
ggaaaatctcatcaaaagatttgccaaaaagctatggattttttctctctggaagaacct
aaatacttcgtctaa

DBGET integrated database retrieval system