KEGG   Prochlorococcus marinus NATL2A: PMN2A_0811Help
Entry
PMN2A_0811        CDS       T00267                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pmn00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1314542..1315456)
Genome map
AA seq 304 aa AA seqDB search
MSIDLVVPKEVELPTLLDELRKLSWASADVLMAYARGGEPPYGFPKSLNVEEGGDGPVSA
ADMAVNELLISGLKDNLAFKEWDILSEETSKEKTFQQDNYKKDWCWILDPLDGTKDFLQG
SENYAVHIALAYKKKPKIGIVLIPEKNELWFGIVGIGAWFEDRDGSKNHFSFSDRLDISK
LILVSSKNHQQSKLNNLLSTLCFGETKKIGSVGCKVASILRGEADVYISLSGKTSPKDWD
MAAPHALIEAAGGMFSHADGKNLVYQEKNYSQSGCLIASHGKSHQKICQKAMDFFSLEEP
KYFV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgatcttgttgtgccaaaagaggtcgaattaccgactttattggatgagctt
agaaagcttagctgggcttccgctgatgttttgatggcatatgcaagaggtggtgaacct
ccatatggcttccctaaatcattaaatgtagaggaaggcggggatggcccagtatctgca
gctgacatggcagtgaatgaattattgatctctggattgaaggataatctcgctttcaaa
gaatgggatattttaagcgaagaaacttctaaggagaaaacttttcagcaagataattat
aaaaaagattggtgttggattcttgatccattagatgggacaaaggattttcttcaagga
tctgaaaactatgcagttcatattgctttggcgtacaaaaaaaagccaaaaatcgggata
gttttgatacctgaaaagaatgaattatggtttggaattgttgggattggtgcatggttt
gaagatcgtgatggctctaaaaaccacttttcttttagtgatagattggatatttcgaaa
ttgatactagtttcaagtaaaaatcatcaacaatcaaaacttaataaccttctgtcaact
ctgtgctttggtgagacaaaaaaaataggcagtgtcggttgtaaagttgcttcaatcttg
aggggagaagcagatgtttatatctctctatctggaaaaacttcacccaaggattgggat
atggctgctccacatgctcttattgaggcggctggtggtatgttctctcatgcagatgga
aaaaatttagtttaccaagaaaaaaactattctcaatctggttgtttaattgcaagccat
ggaaaatctcatcaaaagatttgccaaaaagctatggattttttctctctggaagaacct
aaatacttcgtctaa

DBGET integrated database retrieval system