KEGG   Prochlorococcus marinus NATL2A: PMN2A_0863Help
Entry
PMN2A_0863        CDS       T00267                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PMN2A_0863 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PMN2A_0863 (trpC)
Enzymes [BR:pmn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PMN2A_0863 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1366737..1367624)
Genome map
AA seq 295 aa AA seqDB search
MEIRRRPPNPSIKVANLEYAIPHPDSKPKNILEEIVWEKHLEVEIARKKVSLEDLKKKIK
DLPKTKNFIDALRNSNSKPALISEIKKASPSRGIIREDFDAKMIGKMYQEGGANCISVLT
DKKFFQGGFDVLVEVRKEIIIPILCKDFILYPYQLYQARAAGADAALLIAAILTDSDLKY
LSKVAEHLGLTILVEVHDSEELERVLNINVFNLIGINNRNLKSFKTDLEVTKKLAENYAN
QIKENSITLVSESGLFNREDLDLVKSYGADAVLVGESLMSQEDILGGVKKLIGNL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaaattagaagaagacctcctaacccaagtataaaagtagctaatttagagtatgca
attcctcacccagattcaaaacctaaaaatattttggaggaaattgtttgggaaaaacat
ctagaagttgagattgcaagaaaaaaagtttcgcttgaagatttaaagaaaaagatcaag
gatttaccaaaaacaaaaaatttcatagatgcattaagaaatagtaattcgaaaccagca
ctaatctcagaaataaaaaaggctagtccaagtagagggataattagagaagactttgac
gcgaaaatgataggtaaaatgtatcaagaggggggtgctaactgcatatcggtcttaaca
gataaaaaattttttcaaggtggttttgatgtcttagtggaagttagaaaggaaatcata
atcccaatcctatgtaaggactttatcctttacccctatcagctttaccaagcaagagct
gctggtgctgatgctgcacttttgatagcggcaattctgactgattctgatttaaagtac
ttatctaaggtcgctgaacatttgggacttacaatattagtagaggttcatgactcagaa
gaacttgaacgagtactaaatattaatgtatttaatttaataggtattaataatagaaat
ttaaagagttttaaaactgatcttgaggttacaaagaaattggccgagaattatgctaac
caaatcaaggaaaattctattactttggtaagcgagtcaggtttatttaatcgtgaggat
ttggatttagtgaagagttatggggctgatgctgttttagttggtgaatctcttatgtca
caggaagatatattaggtggagttaaaaagttaattggcaacttataa

DBGET integrated database retrieval system