KEGG   Prochlorococcus marinus NATL2A: PMN2A_0863Help
Entry
PMN2A_0863        CDS       T00267                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmn01100  Metabolic pathways
pmn01110  Biosynthesis of secondary metabolites
pmn01130  Biosynthesis of antibiotics
pmn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PMN2A_0863
Enzymes [BR:pmn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PMN2A_0863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS DAHP_synth_1 QRPTase_C DUF3336
Motif
Other DBs
NCBI-ProteinID: AAZ58354
CYORF: PMN2A_0863
UniProt: Q46JH4
Position
complement(1366737..1367624)
Genome map
AA seq 295 aa AA seqDB search
MEIRRRPPNPSIKVANLEYAIPHPDSKPKNILEEIVWEKHLEVEIARKKVSLEDLKKKIK
DLPKTKNFIDALRNSNSKPALISEIKKASPSRGIIREDFDAKMIGKMYQEGGANCISVLT
DKKFFQGGFDVLVEVRKEIIIPILCKDFILYPYQLYQARAAGADAALLIAAILTDSDLKY
LSKVAEHLGLTILVEVHDSEELERVLNINVFNLIGINNRNLKSFKTDLEVTKKLAENYAN
QIKENSITLVSESGLFNREDLDLVKSYGADAVLVGESLMSQEDILGGVKKLIGNL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaaattagaagaagacctcctaacccaagtataaaagtagctaatttagagtatgca
attcctcacccagattcaaaacctaaaaatattttggaggaaattgtttgggaaaaacat
ctagaagttgagattgcaagaaaaaaagtttcgcttgaagatttaaagaaaaagatcaag
gatttaccaaaaacaaaaaatttcatagatgcattaagaaatagtaattcgaaaccagca
ctaatctcagaaataaaaaaggctagtccaagtagagggataattagagaagactttgac
gcgaaaatgataggtaaaatgtatcaagaggggggtgctaactgcatatcggtcttaaca
gataaaaaattttttcaaggtggttttgatgtcttagtggaagttagaaaggaaatcata
atcccaatcctatgtaaggactttatcctttacccctatcagctttaccaagcaagagct
gctggtgctgatgctgcacttttgatagcggcaattctgactgattctgatttaaagtac
ttatctaaggtcgctgaacatttgggacttacaatattagtagaggttcatgactcagaa
gaacttgaacgagtactaaatattaatgtatttaatttaataggtattaataatagaaat
ttaaagagttttaaaactgatcttgaggttacaaagaaattggccgagaattatgctaac
caaatcaaggaaaattctattactttggtaagcgagtcaggtttatttaatcgtgaggat
ttggatttagtgaagagttatggggctgatgctgttttagttggtgaatctcttatgtca
caggaagatatattaggtggagttaaaaagttaattggcaacttataa

DBGET integrated database retrieval system