KEGG   Prochlorococcus marinus NATL2A: PMN2A_1019Help
Entry
PMN2A_1019        CDS       T00267                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmn01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pmn00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1514582..1515931
Genome map
AA seq 449 aa AA seqDB search
MTQIINKDEVQETSSKKLTIKTANSIDQAQFELRKITERTSGTVQDEAIKVVDDILKNVR
ERGDEALTEYTSRFDGFLTEKFQVSSDLILKAWEETPRELQDSLLLAKKRIEKFHSLQVP
KNITYTGPNGETLGRRWSPVEKAGIYVPGGRAAYPSTVLMNAIPAYVAGVNQIIMVSPAN
SQGEINQTVLAAAHITGINKIFRLGGAQAICALASGTESIPKVDVITGPGNIYVTLAKKK
VYGKVGIDSLAGPSEILIIADQSAKLEHVASDMLAQSEHDPLASAILITTNTKLAEKLPA
EINRQLINHPRLKICQESISNWGLIVLCDDLETCAQLSDTFAPEHLELLVEDPKKLSESI
NNAGAIFMGPWSPEAIGDYLGGPNHTLPTSGTARFAGALGVETFMKNTSLIDFSKEAFNE
NKNAVVQLANSEGLHSHAESIRIRDSKSF
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaataattaataaagacgaggttcaagaaacctcttcaaaaaaattgaccata
aaaacagctaatagcattgatcaggcacagtttgagctaaggaaaattactgagagaaca
tctggaaccgttcaagatgaagctataaaggtagttgacgatattcttaaaaacgtaagg
gaaagaggggatgaggcacttacagaatacacttctcgctttgatggatttctaacggaa
aaatttcaagtttcatcagatttaatactgaaagcttgggaagagactcctagggaactt
caagattcacttttattggcaaaaaaaagaattgaaaaatttcatagtcttcaagtacca
aaaaatattacttatacaggacccaatggtgaaacacttggaagaagatggagccctgtt
gaaaaagcaggcatttatgttcctggcggaagagccgcctatcccagcaccgtgttaatg
aatgctattcctgcttatgttgcaggagttaatcaaattattatggtttctcctgctaac
tctcaaggagagataaaccaaaccgttttagctgcagcacatattacaggtatcaacaaa
atctttcgtcttggaggcgctcaagctatttgcgcacttgctagtggaactgaatcaatt
ccaaaagtagatgtaattactggtccaggaaatatttatgtaacgttggcaaagaaaaaa
gtttatggaaaggtaggaattgattctttggctggtccaagcgagatcctaataatcgct
gatcaatcagcaaaattagaacatgttgcatctgatatgttagctcagtcagaacatgat
cctttagcctcagcgatactaatcactacaaatacaaaattagctgaaaagttacccgca
gaaattaaccgtcaattaattaatcatccaagattaaaaatatgtcaagaatcaatttcc
aactggggtttaatagtcctttgtgatgatttagaaacttgtgcgcaattaagcgatact
tttgccccagaacatcttgaattacttgtagaggacccaaaaaaattatcagaaagcata
aacaatgctggggcaatatttatgggcccatggagcccagaggctattggagattatctt
ggcgggcctaatcacactcttcccacttctggaactgcaagatttgctggcgctcttggg
gttgaaacttttatgaaaaatacctcacttatagatttttcaaaagaagcatttaatgaa
aataaaaatgcagttgtacagttagccaatagcgagggactacatagtcatgcagaatca
atacgaattagagactctaaatctttttaa

DBGET integrated database retrieval system