KEGG   Prochlorococcus marinus NATL2A: PMN2A_1240Help
Entry
PMN2A_1240        CDS       T00267                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PMN2A_1240
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PMN2A_1240
Enzymes [BR:pmn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     PMN2A_1240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1742062..1742652)
Genome map
AA seq 196 aa AA seqDB search
MNVQSINNSIGELLEGPLVFSPCLFNDERGNFFESWNSQIFDDLLLNHDQGPQIFLQDNQ
SFSRKGVLRGLHYQITPHVQGKLVRCIAGEIYDVIVDLRMSSKTFKSWGSINLSAQNKKQ
LWVPVGFAHGFLSLTDCTEVLYKTTDYWDPKCERGISWDDPDIKIIWPENFLHPELSKKD
LMLPSFSELKSMDMFE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttcaatctattaataattcaattggagagcttcttgagggccctttggtcttt
tcgccttgtctttttaatgatgaaagagggaatttttttgagagctggaattctcaaata
tttgatgatttactgttaaatcatgatcaaggtcctcagatatttcttcaagataatcaa
tctttctctcgaaagggagtcttacgaggattgcattatcaaattactcctcacgttcaa
gggaagttggtgcgttgtatcgctggcgaaatatacgatgttatagttgatttaagaatg
tcatccaagaccttcaagtcttggggatcaatcaacttaagtgcccagaataagaagcag
ttatgggttccagttggatttgctcatggatttctatctttaactgattgtacagaggtt
ttatataagacaactgattactgggatcctaaatgtgaacgcggtataagttgggatgat
ccagatattaaaattatctggccagaaaattttctgcatcctgaattatcaaagaaggat
ttaatgttgccttctttttcagagttaaaaagtatggacatgtttgaatga

DBGET integrated database retrieval system