KEGG   Prochlorococcus marinus NATL2A: PMN2A_1271Help
Entry
PMN2A_1271        CDS       T00267                                 

Definition
fatty acid desaturase (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PMN2A_1271
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PMN2A_1271
Enzymes [BR:pmn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PMN2A_1271
Lipid biosynthesis proteins [BR:pmn01004]
 Desaturase
  First
   PMN2A_1271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1777947..1778876
Genome map
AA seq 309 aa AA seqDB search
MVSSLIEASAPLKKPVAADKAMAASKKLQGHVPRRIQNKRARKRWGTVIFMLTIHALTIF
TLQAQFWSWLAFSGFIFLYWVTACLGVTTGYHRLLSHRSFQVPKWLERFFATCGALSCQH
GPIDWVGLHRHHHTFSDTEADHHDSNKGFWWSHMGWMFEDVPAMKAVPRLSGDLIKDPYY
RFLNKNFLLLQLPLGATLYLIGQSAGVGGWAMVLWGIPLRLVFVYHITWLVNSATHCWGT
IAYESGDNSKNNKWVAALTFGEGWHNNHHAFPNSAKHGLQRKQIDLTWQHIRFLKAIGLA
KKIRLPVAS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtttcaagtttgatcgaagcttcggctccattaaaaaaaccagttgctgccgataaa
gcgatggctgcatcgaagaagcttcaaggccatgtaccaaggcggattcagaataaaagg
gcgagaaaaagatggggaacagtcatattcatgctgacaatacatgctttaaccatattt
actttgcaagctcaattttggagctggcttgcattttctggatttattttcttgtattgg
gtaactgcttgcttgggagtaacgacaggatatcatcgccttctttcacatcgttctttt
caagttccaaaatggcttgaaagattttttgcaacttgtggagcattaagttgccaacat
ggaccaattgattgggtcggtcttcataggcatcatcatactttttccgatactgaagct
gatcatcatgacagtaataagggattctggtggagtcacatgggatggatgtttgaagat
gtacctgccatgaaagcggtaccaagactttctggagatttaatcaaagatccatactat
cggttcttaaataaaaattttttacttttgcaactacccttaggcgcaacactttattta
attggacaatcagctggagttggaggatgggcaatggtcctatggggaatacctctaaga
ctcgtttttgtttatcacataacttggctagttaattcagcaactcattgttggggaact
attgcgtatgagagtggggataattcaaaaaataataaatgggtagcagcacttacattt
ggtgaaggatggcacaataatcatcatgctttccctaattcagcaaagcatggccttcaa
cgcaaacaaatagatctaacttggcaacacatacgttttttgaaagcaattggcttagct
aaaaaaattagactccctgtcgcgtcgtaa

DBGET integrated database retrieval system