KEGG   Prochlorococcus marinus NATL2A: PMN2A_1271Help
Entry
PMN2A_1271        CDS       T00267                                 

Definition
fatty acid desaturase (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pmn01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pmn01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1777947..1778876
Genome map
AA seq 309 aa AA seqDB search
MVSSLIEASAPLKKPVAADKAMAASKKLQGHVPRRIQNKRARKRWGTVIFMLTIHALTIF
TLQAQFWSWLAFSGFIFLYWVTACLGVTTGYHRLLSHRSFQVPKWLERFFATCGALSCQH
GPIDWVGLHRHHHTFSDTEADHHDSNKGFWWSHMGWMFEDVPAMKAVPRLSGDLIKDPYY
RFLNKNFLLLQLPLGATLYLIGQSAGVGGWAMVLWGIPLRLVFVYHITWLVNSATHCWGT
IAYESGDNSKNNKWVAALTFGEGWHNNHHAFPNSAKHGLQRKQIDLTWQHIRFLKAIGLA
KKIRLPVAS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtttcaagtttgatcgaagcttcggctccattaaaaaaaccagttgctgccgataaa
gcgatggctgcatcgaagaagcttcaaggccatgtaccaaggcggattcagaataaaagg
gcgagaaaaagatggggaacagtcatattcatgctgacaatacatgctttaaccatattt
actttgcaagctcaattttggagctggcttgcattttctggatttattttcttgtattgg
gtaactgcttgcttgggagtaacgacaggatatcatcgccttctttcacatcgttctttt
caagttccaaaatggcttgaaagattttttgcaacttgtggagcattaagttgccaacat
ggaccaattgattgggtcggtcttcataggcatcatcatactttttccgatactgaagct
gatcatcatgacagtaataagggattctggtggagtcacatgggatggatgtttgaagat
gtacctgccatgaaagcggtaccaagactttctggagatttaatcaaagatccatactat
cggttcttaaataaaaattttttacttttgcaactacccttaggcgcaacactttattta
attggacaatcagctggagttggaggatgggcaatggtcctatggggaatacctctaaga
ctcgtttttgtttatcacataacttggctagttaattcagcaactcattgttggggaact
attgcgtatgagagtggggataattcaaaaaataataaatgggtagcagcacttacattt
ggtgaaggatggcacaataatcatcatgctttccctaattcagcaaagcatggccttcaa
cgcaaacaaatagatctaacttggcaacacatacgttttttgaaagcaattggcttagct
aaaaaaattagactccctgtcgcgtcgtaa

DBGET integrated database retrieval system