KEGG   Prochlorococcus marinus NATL2A: PMN2A_1287Help
Entry
PMN2A_1287        CDS       T00267                                 

Definition
arginase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PMN2A_1287
Enzymes [BR:pmn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PMN2A_1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1793976..1794875
Genome map
AA seq 299 aa AA seqDB search
MTKSNLRDLSLFNNDGAIFMGAQRDIDQSRVSLLGVPYDGTCCFRPGARFGPSAIREDSY
GIETYCPQLDLDLEDINFTDIGSLDVPLGDAELTLDYISDATNILLKNNLKPLIIGGEHS
ITIGIIKSIITNYPDLIMLQLDAHADLRDEWLGSKLSHACTMKRCLEILPSKKIFQIGIR
SGTKSEFLEMNNSKRFIQHTLGENAKSLEEALKSFKGRPIYLTFDLDWFDPSVMPGTGTP
EPGGYFWGDFAAIINVIKSHNLIGADVVELSPKLDTTGISSILAAKVIRSLIMLLDKSS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatccaacctaagagatctatcactatttaataacgatggtgcaatatttatg
ggcgcccaaagagacatcgatcaatccagagtgtcgcttttaggagttccttatgatgga
acttgttgctttaggcctggtgcaagatttggtccttctgctattagggaagatagttat
ggaattgaaacatattgtccgcaattagatttagatttagaagatattaactttactgat
ataggttcattagatgttccccttggagatgcagaattaacacttgattatataagcgat
gctacaaatattttacttaaaaataatttaaagcctcttattattggtggagaacattca
ataacaattgggattattaaatcaataattactaattatcctgacttaattatgcttcaa
ttagatgctcacgcagaccttagagatgaatggttaggtagtaaattaagtcatgcatgt
actatgaaaagatgtttagaaatactacctagcaaaaagatctttcaaataggaataaga
agtggaacaaaatcagaatttcttgaaatgaataatagtaaaaggttcattcaacatact
ttaggagagaatgcaaaatctttagaagaagctctaaaaagttttaaagggagaccaatc
tatttaacttttgatttagattggtttgatccctctgtaatgccaggaactggcactcct
gagcccgggggctatttttggggagattttgcagcaataataaatgtgattaagtctcat
aacttaattggtgctgatgtagtcgaattatctcccaaattagataccactggtattagt
agcatccttgctgcaaaagttatacgttcattaattatgttattggacaaatcatcctaa

DBGET integrated database retrieval system