KEGG   Prochlorococcus marinus NATL2A: PMN2A_1327Help
Entry
PMN2A_1327        CDS       T00267                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PMN2A_1327
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMN2A_1327
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PMN2A_1327
Enzymes [BR:pmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PMN2A_1327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1841606..1842712
Genome map
AA seq 368 aa AA seqDB search
MSFSKKLKQLFTSTPPKNNWDGLIETYKTWLPVSNKTPIITLKEGATPLIEVKSISNRIG
NGVKVFVKYDGLNPTGSFKDRGMTMAISKAKEAGCEAVICASTGNTSASAAAYASKGGMK
SFVIIPDGYVAQGKLAQALVYGAEVLAIKGNFDKALDIVRELSDKYPITLVNSVNPYRLQ
GQKTAAFEIIENLGNAPDWLCIPMGNAGNISAYWMGFQEFFHAGKSKRLPRMMGFQASGS
APLVEGKSINNPETIATAIRIGNPVNKEKAILAKESSNGRFSSVSDSEIINAYKILGREE
GIFCEPASAASVAGLLKIKEDVPKNSTIVCVLTGNGLKDPDCAIKNNDSIFHTGVEAEIN
SITKIMGF
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgtcattttctaagaaattaaaacaacttttcacttctaccccccccaaaaacaattgg
gatggacttatagaaacatacaaaacttggttaccagtaagtaataagacacccatcatt
actttaaaagaaggcgcaactcctctgattgaagtcaaatccatttctaatcgaattgga
aatggagtaaaagtatttgtcaaatatgacggtctaaatccgactggatccttcaaagac
agaggaatgactatggcgattagtaaagctaaagaagctgggtgtgaagctgtcatttgc
gcaagcacaggtaatacttcagcatctgcagcagcttatgcaagcaaaggaggaatgaaa
tcctttgtaattattccagatggatatgtagctcaaggtaaactagctcaagctttagtt
tacggagctgaagtattagctattaaagggaattttgataaagcactagatattgttaga
gaactatctgataaatatccaattactttagttaactcagtgaatccttacaggttacaa
ggacaaaaaaccgcagcatttgagataatagaaaatcttggaaatgcgcctgattggtta
tgcattccaatgggaaatgctggaaatataagtgcttattggatgggctttcaagaattt
tttcacgctggaaaatcaaaacgtctcccaagaatgatgggttttcaagcgagtggttct
gcgcctttagtcgaaggtaaaagtatcaataacccagagacaattgctactgcaataaga
attggtaatcctgttaataaagaaaaagctattttagcaaaagaatcaagtaatggtaga
ttttcttccgtgtcagattcagaaataatcaacgcatacaaaattcttggtagagaagaa
ggcattttttgtgagcctgcaagtgcagcttctgtggctggtctattaaaaataaaagaa
gatgtcccaaaaaattcaactattgtttgtgttttgacagggaatggtctaaaagatcct
gattgcgcaataaaaaataatgattcaatctttcatacgggagtagaagcagaaataaat
tcaataacaaaaataatgggcttttaa

DBGET integrated database retrieval system