KEGG   Prochlorococcus marinus NATL2A: PMN2A_1350Help
Entry
PMN2A_1350        CDS       T00267                                 

Definition
glyceraldehyde 3-phosphate dehydrogenase(NADP+)(phosphorylating) (EC:1.2.1.13)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Class
Metabolism; Overview; Carbon metabolism [PATH:pmn01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmn01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pmn00010]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:pmn00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
24728..25750
Genome map
AA seq 340 aa AA seqDB search
MTLRVAINGFGRIGRNFMRCWLSRGANTNIEVVGINVTSDPKTCAHLLKYDSILGAIKDA
EISHTDDTFQINGKTIKCYSDRNPLNLPWKEWGIDLVIESTGVFNTDVGASKHLQVGAKK
VILTAPGKGDGVGTYVVGVNADSYSHEDFDILSNASCTTNCLAPIVKVLDQKLGINKGLM
TTIHSYTGDQRILDNAHRDLRRARAAAMNLVPTSTGAAKAVALVYPQMKGKLTGIAMRVP
TPNVSAVDLVFESGRKTSAEEVNSLLKTASQGEMKGIIKYGDLPLVSTDYAGTNESTIVD
EALTMCIDDNMVKVLAWYDNEWGYSQRVVDLAEIVAQKWK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgactttgcgtgtagcgattaatggattcggaagaattggacgcaattttatgcgttgt
tggctgagtaggggtgcaaatacaaatattgaagtggtcggcattaacgtcacttctgat
ccaaaaacttgtgcacatttgctcaaatatgactctattctaggtgctattaaagacgcc
gaaatttcacatacggacgatacatttcaaattaatggcaaaactataaaatgttattca
gatagaaaccctttaaatcttccttggaaagagtggggaattgatttagtaattgagtca
acaggtgtattcaatacagatgttggtgctagtaagcatctacaagttggggccaagaag
gtaattcttactgcacctgggaagggtgatggtgtaggtacttatgtagttggtgttaac
gctgattcatactctcatgaagattttgatatccttagcaatgcaagttgcaccaccaat
tgtttagcgccaatcgtaaaagttttagatcaaaagttggggattaataaaggcttaatg
accacgattcatagttatacgggagatcaaagaattcttgacaatgctcatcgtgattta
cgtcgcgcaagagcagcagcaatgaatttggtccctacttcaactggtgcggcaaaggct
gttgctcttgtttatccacaaatgaaagggaaactaactggtattgcgatgcgagtccct
acacctaatgtttctgcggttgatttggtttttgaatcaggacgtaaaactagtgctgaa
gaggtcaattcattacttaaaaccgcttcacagggagaaatgaaaggaatcattaaatat
ggtgatttgcctctggtttctactgactatgcgggaacgaatgaatcaaccattgttgat
gaagcattaacaatgtgcatcgatgacaatatggtcaaagtcttagcttggtatgacaat
gagtggggttacagtcaaagggtagttgacttggctgaaattgttgcccaaaaatggaag
taa

DBGET integrated database retrieval system