KEGG   Prochlorococcus marinus NATL2A: PMN2A_1350Help
Entry
PMN2A_1350        CDS       T00267                                 

Definition
(GenBank) glyceraldehyde 3-phosphate dehydrogenase (NADP+)
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
pmn00010  Glycolysis / Gluconeogenesis
pmn00710  Carbon fixation in photosynthetic organisms
pmn01100  Metabolic pathways
pmn01110  Biosynthesis of secondary metabolites
pmn01120  Microbial metabolism in diverse environments
pmn01130  Biosynthesis of antibiotics
pmn01200  Carbon metabolism
pmn01230  Biosynthesis of amino acids
Module
pmn_M00002  Glycolysis, core module involving three-carbon compounds
pmn_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pmn_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pmn_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMN2A_1350
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PMN2A_1350
Enzymes [BR:pmn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     PMN2A_1350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: AAZ58839
CYORF: PMN2A_1350
UniProt: Q46I39
Position
24728..25750
Genome map
AA seq 340 aa AA seqDB search
MTLRVAINGFGRIGRNFMRCWLSRGANTNIEVVGINVTSDPKTCAHLLKYDSILGAIKDA
EISHTDDTFQINGKTIKCYSDRNPLNLPWKEWGIDLVIESTGVFNTDVGASKHLQVGAKK
VILTAPGKGDGVGTYVVGVNADSYSHEDFDILSNASCTTNCLAPIVKVLDQKLGINKGLM
TTIHSYTGDQRILDNAHRDLRRARAAAMNLVPTSTGAAKAVALVYPQMKGKLTGIAMRVP
TPNVSAVDLVFESGRKTSAEEVNSLLKTASQGEMKGIIKYGDLPLVSTDYAGTNESTIVD
EALTMCIDDNMVKVLAWYDNEWGYSQRVVDLAEIVAQKWK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgactttgcgtgtagcgattaatggattcggaagaattggacgcaattttatgcgttgt
tggctgagtaggggtgcaaatacaaatattgaagtggtcggcattaacgtcacttctgat
ccaaaaacttgtgcacatttgctcaaatatgactctattctaggtgctattaaagacgcc
gaaatttcacatacggacgatacatttcaaattaatggcaaaactataaaatgttattca
gatagaaaccctttaaatcttccttggaaagagtggggaattgatttagtaattgagtca
acaggtgtattcaatacagatgttggtgctagtaagcatctacaagttggggccaagaag
gtaattcttactgcacctgggaagggtgatggtgtaggtacttatgtagttggtgttaac
gctgattcatactctcatgaagattttgatatccttagcaatgcaagttgcaccaccaat
tgtttagcgccaatcgtaaaagttttagatcaaaagttggggattaataaaggcttaatg
accacgattcatagttatacgggagatcaaagaattcttgacaatgctcatcgtgattta
cgtcgcgcaagagcagcagcaatgaatttggtccctacttcaactggtgcggcaaaggct
gttgctcttgtttatccacaaatgaaagggaaactaactggtattgcgatgcgagtccct
acacctaatgtttctgcggttgatttggtttttgaatcaggacgtaaaactagtgctgaa
gaggtcaattcattacttaaaaccgcttcacagggagaaatgaaaggaatcattaaatat
ggtgatttgcctctggtttctactgactatgcgggaacgaatgaatcaaccattgttgat
gaagcattaacaatgtgcatcgatgacaatatggtcaaagtcttagcttggtatgacaat
gagtggggttacagtcaaagggtagttgacttggctgaaattgttgcccaaaaatggaag
taa

DBGET integrated database retrieval system