KEGG   Prochlorococcus marinus NATL2A: PMN2A_1350Help
Entry
PMN2A_1350        CDS       T00267                                 

Definition
(RefSeq) glyceraldehyde 3-phosphate dehydrogenase(NADP+)(phosphorylating) (EC:1.2.1.13)
  KO
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PMN2A_1350
   01230 Biosynthesis of amino acids
    PMN2A_1350
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMN2A_1350
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PMN2A_1350
Enzymes [BR:pmn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     PMN2A_1350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
24728..25750
Genome map
AA seq 340 aa AA seqDB search
MTLRVAINGFGRIGRNFMRCWLSRGANTNIEVVGINVTSDPKTCAHLLKYDSILGAIKDA
EISHTDDTFQINGKTIKCYSDRNPLNLPWKEWGIDLVIESTGVFNTDVGASKHLQVGAKK
VILTAPGKGDGVGTYVVGVNADSYSHEDFDILSNASCTTNCLAPIVKVLDQKLGINKGLM
TTIHSYTGDQRILDNAHRDLRRARAAAMNLVPTSTGAAKAVALVYPQMKGKLTGIAMRVP
TPNVSAVDLVFESGRKTSAEEVNSLLKTASQGEMKGIIKYGDLPLVSTDYAGTNESTIVD
EALTMCIDDNMVKVLAWYDNEWGYSQRVVDLAEIVAQKWK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgactttgcgtgtagcgattaatggattcggaagaattggacgcaattttatgcgttgt
tggctgagtaggggtgcaaatacaaatattgaagtggtcggcattaacgtcacttctgat
ccaaaaacttgtgcacatttgctcaaatatgactctattctaggtgctattaaagacgcc
gaaatttcacatacggacgatacatttcaaattaatggcaaaactataaaatgttattca
gatagaaaccctttaaatcttccttggaaagagtggggaattgatttagtaattgagtca
acaggtgtattcaatacagatgttggtgctagtaagcatctacaagttggggccaagaag
gtaattcttactgcacctgggaagggtgatggtgtaggtacttatgtagttggtgttaac
gctgattcatactctcatgaagattttgatatccttagcaatgcaagttgcaccaccaat
tgtttagcgccaatcgtaaaagttttagatcaaaagttggggattaataaaggcttaatg
accacgattcatagttatacgggagatcaaagaattcttgacaatgctcatcgtgattta
cgtcgcgcaagagcagcagcaatgaatttggtccctacttcaactggtgcggcaaaggct
gttgctcttgtttatccacaaatgaaagggaaactaactggtattgcgatgcgagtccct
acacctaatgtttctgcggttgatttggtttttgaatcaggacgtaaaactagtgctgaa
gaggtcaattcattacttaaaaccgcttcacagggagaaatgaaaggaatcattaaatat
ggtgatttgcctctggtttctactgactatgcgggaacgaatgaatcaaccattgttgat
gaagcattaacaatgtgcatcgatgacaatatggtcaaagtcttagcttggtatgacaat
gagtggggttacagtcaaagggtagttgacttggctgaaattgttgcccaaaaatggaag
taa

DBGET integrated database retrieval system