KEGG   Prochlorococcus marinus NATL2A: PMN2A_1482Help
Entry
PMN2A_1482        CDS       T00267                                 

Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PMN2A_1482
Enzymes [BR:pmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PMN2A_1482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
157638..158438
Genome map
AA seq 266 aa AA seqDB search
MKHTEMSLTDKKIIITRAQEQTSEARKIFRKNGAEVFDLPSLVIGPPDDWAPLDDALKKI
STFDWIIFSSANGVRNVEDRMREIGLSLSKISKTIQIAAVGRKTASLLSDMDAEISFVPP
SFVADSLLEYFPQNQKGLKLFIPRVQTGGRSILSDSFRLNGAEVTEVAAYESSCPKDVPQ
KTIEALKSGEIDIIAFTSGKTVINTVSLFNKYFGGNWFKLIEKIKLVSIGPQTTISCKKL
IRKPDKEAEPHDLEGLLNACLELKFN
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatacagaaatgtctttaaccgacaagaagataattattactcgtgcccaagaa
cagacttcagaggctcgtaagatctttagaaaaaatggagctgaggtatttgatcttcct
tcattagttattggacctcctgatgactgggctcctttggatgatgctttaaagaaaatc
tcaacctttgattggattatcttttctagcgcaaatggtgttagaaatgttgaagataga
atgagagaaattggattatctttgtcgaaaatttctaagactattcaaattgctgctgta
ggaagaaaaacagcttctttgttatcagatatggatgcagagattagttttgttcctcct
agttttgttgcagatagcttgcttgaatatttccctcagaatcaaaaaggtttaaaatta
tttattccaagagtacaaaccggcggcagatcaatattatctgactctttcaggttaaac
ggagcagaggttactgaagtagctgcttatgaatcttcttgtcctaaagatgtacctcaa
aagactatagaagctttgaagagtggagaaatagatattattgcttttactagtggtaaa
acagtaataaatactgttagcttatttaataaatactttggtggaaattggtttaaattg
attgaaaagattaaacttgtttcgattggacctcaaacaactattagttgtaaaaaactt
attagaaaacctgataaagaggctgaacctcatgatctagaaggattattaaatgcttgc
ctagaactaaaatttaattaa

DBGET integrated database retrieval system