KEGG   Prochlorococcus marinus NATL2A: PMN2A_1531Help
Entry
PMN2A_1531        CDS       T00267                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmn01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pmn00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pmn00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(202373..203626)
Genome map
AA seq 417 aa AA seqDB search
MTGTLPTQFKDSDLSPLTRPNTLGRFGKYGGQYVPETLIPALIELEQAAKEAWKDSSFNS
ELNHLLKTYVGRSTPLYEATRLTEHYRKNTLKGPRIWLKREDLNHTGAHKINNALGQALL
AIRMGKKRIIAETGAGQHGVATATVCARFGLECIIYMGKEDMRRQALNVFRMQLLGASVR
PVTSGTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMLVRDFHAVIGEETKQQCK
QAFGRSPDVLLACVGGGSNAMGLFHSFVEDKSVRMIGVEAAGDGVETGRHAATITEGRIG
VLHGAMSLLLQDKDGQVEEAHSISAGLDYPGVGPEHSYLKEIGRAEYAAVTDTEAIEALQ
LVSKLEGIIPALETAHAFAYLEKLCPTLNHNSEIVINCSGRGDKDVNTVAEKLGSEI
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgacaggtacactcccaacacaatttaaagattcggatttatctcctttaacaaggcca
aatactcttggtcgatttggtaagtatggggggcaatatgttcctgaaactttaatacct
gctcttattgaattagagcaagctgctaaagaagcatggaaagattcttcattcaattca
gaactaaatcatttactaaaaacatacgtaggaagatcaactcctctttatgaagccaca
agactaactgaacattacagaaaaaatacattaaaaggtccaaggatttggcttaaaaga
gaagatttaaatcacacaggcgcacacaaaataaataatgcacttgggcaagctcttctt
gcgattcggatgggaaaaaaaagaattattgctgaaactggagctggtcagcatggagtt
gcaactgcgacagtctgcgctcgttttggattggagtgcattatctatatgggcaaagaa
gatatgagaagacaagccttaaacgtattccgaatgcaattgcttggagcctcagtgagg
ccagtaacaagtggaacagcaacactcaaagatgcaaccagcgaagctattcgggattgg
gttactaatgttgaaacgactcattatattctcggttcagttgcaggcccacatccatat
ccaatgttggtcagagattttcacgcagttattggagaagaaacaaagcaacaatgtaaa
caagcttttgggcggtctccagatgttcttcttgcttgtgttggtgggggatcgaatgcg
atgggtcttttccattcttttgttgaagacaaaagtgtaagaatgattggagttgaagct
gcgggagatggagtcgaaacaggtcgccatgcagcgacaattactgaaggaagaatagga
gttctccacggcgcgatgagtctcttactacaagacaaagatgggcaagttgaggaggcg
cattccattagcgcaggtcttgattatccaggggttgggccggagcatagttacttaaaa
gaaattggacgtgctgaatatgctgctgttactgacactgaagccatagaagcgctgcaa
ttagttagtaaattggaaggtattattcctgctctagagactgctcatgcatttgcctat
ctagaaaaactttgcccaactctcaatcataattctgaaattgtcattaactgctctggc
agaggggataaagacgtgaatactgttgctgaaaaactaggatcagaaatataa

DBGET integrated database retrieval system