KEGG   Prochlorococcus marinus NATL2A: PMN2A_1531Help
Entry
PMN2A_1531        CDS       T00267                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PMN2A_1531
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMN2A_1531
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PMN2A_1531
Enzymes [BR:pmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PMN2A_1531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(202373..203626)
Genome map
AA seq 417 aa AA seqDB search
MTGTLPTQFKDSDLSPLTRPNTLGRFGKYGGQYVPETLIPALIELEQAAKEAWKDSSFNS
ELNHLLKTYVGRSTPLYEATRLTEHYRKNTLKGPRIWLKREDLNHTGAHKINNALGQALL
AIRMGKKRIIAETGAGQHGVATATVCARFGLECIIYMGKEDMRRQALNVFRMQLLGASVR
PVTSGTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMLVRDFHAVIGEETKQQCK
QAFGRSPDVLLACVGGGSNAMGLFHSFVEDKSVRMIGVEAAGDGVETGRHAATITEGRIG
VLHGAMSLLLQDKDGQVEEAHSISAGLDYPGVGPEHSYLKEIGRAEYAAVTDTEAIEALQ
LVSKLEGIIPALETAHAFAYLEKLCPTLNHNSEIVINCSGRGDKDVNTVAEKLGSEI
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgacaggtacactcccaacacaatttaaagattcggatttatctcctttaacaaggcca
aatactcttggtcgatttggtaagtatggggggcaatatgttcctgaaactttaatacct
gctcttattgaattagagcaagctgctaaagaagcatggaaagattcttcattcaattca
gaactaaatcatttactaaaaacatacgtaggaagatcaactcctctttatgaagccaca
agactaactgaacattacagaaaaaatacattaaaaggtccaaggatttggcttaaaaga
gaagatttaaatcacacaggcgcacacaaaataaataatgcacttgggcaagctcttctt
gcgattcggatgggaaaaaaaagaattattgctgaaactggagctggtcagcatggagtt
gcaactgcgacagtctgcgctcgttttggattggagtgcattatctatatgggcaaagaa
gatatgagaagacaagccttaaacgtattccgaatgcaattgcttggagcctcagtgagg
ccagtaacaagtggaacagcaacactcaaagatgcaaccagcgaagctattcgggattgg
gttactaatgttgaaacgactcattatattctcggttcagttgcaggcccacatccatat
ccaatgttggtcagagattttcacgcagttattggagaagaaacaaagcaacaatgtaaa
caagcttttgggcggtctccagatgttcttcttgcttgtgttggtgggggatcgaatgcg
atgggtcttttccattcttttgttgaagacaaaagtgtaagaatgattggagttgaagct
gcgggagatggagtcgaaacaggtcgccatgcagcgacaattactgaaggaagaatagga
gttctccacggcgcgatgagtctcttactacaagacaaagatgggcaagttgaggaggcg
cattccattagcgcaggtcttgattatccaggggttgggccggagcatagttacttaaaa
gaaattggacgtgctgaatatgctgctgttactgacactgaagccatagaagcgctgcaa
ttagttagtaaattggaaggtattattcctgctctagagactgctcatgcatttgcctat
ctagaaaaactttgcccaactctcaatcataattctgaaattgtcattaactgctctggc
agaggggataaagacgtgaatactgttgctgaaaaactaggatcagaaatataa

DBGET integrated database retrieval system