KEGG   Prochlorococcus marinus NATL2A: PMN2A_1583Help
Entry
PMN2A_1583        CDS       T00267                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PMN2A_1583
Enzymes [BR:pmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PMN2A_1583
Exosome [BR:pmn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PMN2A_1583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
254232..255230
Genome map
AA seq 332 aa AA seqDB search
MDLTYRPRRLRRTNSLREMVRENTVSASDFIYPLFVHEGSDTQEIAAMPGTSRWPIDGLI
DEVKRAWNLGIRCVVIFPKVPDEQKTEDGAECFNEKGLIPRTIERLKKEIPEMCVMTDVA
LDPYSCDGHDGIVSDDGIILNDATVNYLCKQAVVQARAGADLIGPSDMMDGRVGAIREAL
DDEGFEHVGIISYTAKYSSAYYGPFREALDSAPRSISNKPIPKNKNTYQMDPANAREAIT
EAQLDEQEGSDILMVKPGLAYLDIIYRLREESELPIAAYNVSGEYSMVKAAAQRGWIDER
EIVLETLLSFKRAGANLILTYHACDAAGWLKE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggatcttacttatcggccccgtcgtcttcgcagaacaaactctttaagagagatggtt
cgagagaacactgtctctgcttctgactttatctaccctctttttgttcatgaagggtca
gatactcaagaaatagccgcgatgccaggtacaagtcgctggcccatagatggattgatt
gatgaagttaagcgtgcttggaatctaggtattagatgtgtcgttattttcccaaaagtt
cctgacgagcaaaaaacagaagatggagctgaatgctttaatgaaaaaggtttaatacca
aggactattgaaagattgaaaaaagagataccggaaatgtgtgttatgactgatgttgct
ttagatccttattcttgtgatggtcatgatggaatagttagtgatgacgggataattttg
aatgatgcaactgttaattatttgtgtaaacaagctgttgttcaggcacgagctggagca
gatttaattggcccaagtgacatgatggatggaagagttggagcaataagagaagcctta
gatgatgaaggttttgaacatgtaggaataattagttatacggcaaaatattcatctgca
tattatggaccgtttagagaagctttagattctgctcctagatcaatatctaataagcct
attccgaaaaataaaaacacctatcagatggatccagctaatgctagggaagcaataact
gaagctcagcttgacgaacaagaaggatcagacattctcatggttaaaccaggtttggct
tacttagatattatttaccgtttaagagaagaatcagaactacctatcgctgcgtataac
gtaagtggggagtactcgatggtcaaagctgctgctcaaagaggctggatagatgaaaga
gaaattgttttggaaaccttattgagttttaaaagagcaggagcaaatctgatccttaca
tatcacgcatgtgatgccgcaggatggttaaaagaataa

DBGET integrated database retrieval system