KEGG   Prochlorococcus marinus NATL2A: PMN2A_1653Help
Entry
PMN2A_1653        CDS       T00267                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pmn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(321994..322575)
Genome map
AA seq 193 aa AA seqDB search
MTYAKQKPELKLVISIGANIPGILGDPIRTIAAMRPHIEKSIIEWNIALNHPKIDSQNFD
KSLSFQWAPLFETDPLGGPIDQPKFINTVLVVEGEGFASVTPNEKAAKCLMKKFLELEKI
AGRERENIEIIWGPRSLDIDFISWGGLQINTDTLILPHPRFSERNFVLIPLAEVLSKTQG
KTKRISSQNIWPE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacttatgcaaaacaaaaaccggaattgaaactcgtcatctcaataggcgcaaatatc
cctggcattctaggagatcccataaggacaatcgctgccatgaggccgcatatagaaaaa
agcataatcgagtggaatattgctttaaatcatccaaaaatagactctcaaaattttgat
aagtctttatcttttcaatgggctcctctatttgagactgatcctttaggggggccaatt
gaccaaccaaaattcattaataccgtacttgttgtggagggagagggttttgcctcagta
accccaaatgaaaaagcagctaaatgtttgatgaaaaaatttttagaattagaaaagatt
gcaggaagggaaagagaaaatatagagattatttgggggccaagatctttggatattgac
ttcatttcttggggcggactacaaataaatactgacactttgattttgcctcatccaaga
tttagtgaaagaaactttgttttaattccccttgcagaagttttatcaaaaacccaaggt
aaaacgaaacgaatcagttctcaaaatatttggcctgaataa

DBGET integrated database retrieval system