KEGG   Prochlorococcus marinus NATL2A: PMN2A_1654Help
Entry
PMN2A_1654        CDS       T00267                                 

Definition
protoporphyrin IX magnesium chelatase subunit ChlD (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PMN2A_1654
Enzymes [BR:pmn01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PMN2A_1654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
322622..324775
Genome map
AA seq 717 aa AA seqDB search
MVSSGLNNNNMSSTSKDIAVKDRANLAFPLAAITGHGTLKLALMLAAVDPGLGGVIIAGG
RGTGKSVLARGLHALLPPIEIIDLDELANTEDGDDSFIYPAGRNLDPSFSGEWDDLTKKL
FTKKIGSYENTDDLENIPTKVVSAPFIQVPLGVTEDRLVGAVDVAASLSSGTPVFQPGLL
AEAHRGVLYIDELNLLDDGIVNLLLASVGAGENRVEREGLSLSHPCRPLLIATYNPEEGG
LRDHLLDRFAIVLSADQLITNEQRVEITQSAISHGQSSEAFSKKWSEDTESLSTQLLLAR
QWLPDVQISEDQIEYLVVEAIRGGVEGHRSELYSVRVAKAHAALCGRDSVDAEDLKAAVR
LVIAPRAMQMPSEEEMEPPAPEDQQPPPPPPEDSDDNNDQEEDQEEDQEEEQDEESSPPI
PEEFMLDPEACAVDPDLLLFSSTKSKSGNSGSRSAVLSDNRGRYVKPIIPRGPVRRIAVD
ATLRAAAPYQKARREREPNRKVIVEEGDLRAKLLQRKAGALVIFLVDASGSMALNRMQSA
KGAVIRLLTEAYENRDEVSLIPFRGDQAEVLLPPTRSITAAKRRLEAMPCGGGSPLAHGL
TQAARVGANALATGDLGQVVVVAITDGRGNVPLSTSLGQPILEGETPPDLKQEVLDVASR
YRALGIKLLVIDTERKFIASGMGKDLADASGGKYVQLPKASDKAIASIAMDAINSVT
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggtttccagtggattgaacaataacaatatgtcttcgacttcaaaagacattgctgta
aaggatagagccaatcttgctttccctttggctgcaattacaggccatggaactttaaag
cttgctttaatgctcgccgcagttgatcctggtttgggaggagtaataattgcgggtggt
cgcgggactgggaaatctgttttagctagaggcttacatgcccttctcccgccgattgaa
ataattgatttagacgaattagccaatactgaggatggagatgattcatttatttatccg
gcaggtagaaatttagatccttctttttcaggcgaatgggatgatttaactaaaaaactt
ttcacaaaaaagatagggagttatgaaaatactgatgacttagaaaatatccctacaaaa
gttgtttctgcgccctttattcaggttcctttaggagtaacggaggataggcttgttggt
gcagttgatgtcgctgcttcattatcaagcggaactccagtatttcagccaggcttacta
gctgaggctcacagaggagttttgtacatagacgaattgaatttattggatgacggcatt
gtcaatctacttttggcttcagtaggtgcaggtgaaaatagagttgaacgagaaggattg
agcctaagtcacccttgccgtcctcttttgattgctacttacaatcctgaagagggggga
ttaagggaccacctcttggacagatttgcaattgttttatctgcagatcaattaattaca
aacgaacaaagagttgaaataactcaatctgccatttctcatggtcaatcaagtgaagct
ttttctaagaaatggtctgaagacacagaatctctatcaacacaattgcttttggcaagg
caatggcttccagatgttcaaatcagtgaggatcaaattgaatacttagttgtggaagct
atacgtggaggtgtagaaggacacagatcagagctttattcagtaagggttgcaaaggct
catgctgccttgtgtggaagggattcagtggacgcagaagatttaaaagcggcagtaaga
cttgtcatcgctcccagggccatgcaaatgccgtcagaagaggagatggagcctccggcc
cctgaagatcagcagccaccaccaccgcctcctgaagactctgatgacaataatgatcaa
gaggaagatcaagaagaagatcaggaagaggagcaagatgaagagtcatctcctccaatc
ccagaggaatttatgcttgatccagaagcatgtgccgtagatcctgatttgttgttgttt
tcatctactaaatcaaagagtggaaatagcggaagtcgatcagctgtcttaagtgataac
agaggtcgatacgtgaaaccaattattcctagaggacctgttagaaggattgccgttgat
gcaaccttaagagctgcagctccttatcagaaagcaagaagggaaagagaacctaatagg
aaagttattgttgaggaaggcgatctacgcgcaaaattactgcagcgtaaagctggggca
ttggtaattttcttggttgatgcaagtggatcaatggcgctcaatagaatgcaaagtgca
aagggagctgttattcggttgctaaccgaagcttatgaaaacagagatgaagtttctctt
atacctttcagaggggatcaagcagaagttttactccctccaaccagatcaatcaccgct
gcgaaaaggagacttgaggcaatgccatgtggtggtggctctccactagctcatgggtta
actcaggctgcaagagttggagcaaatgccttagccacaggagatctcggacaggttgta
gtagtggcaattacggatgggcgtggaaacgttccattaagcacttcactaggtcaacca
attcttgagggagagacaccacccgacttgaagcaagaagttcttgatgtcgcttcgcgt
tatcgtgctcttggtattaaattgcttgtaattgatacagaaagaaagtttattgctagt
ggaatgggtaaagacttggctgacgcatccggaggtaaatatgttcaattacctaaggca
agtgataaggctattgcttcaattgcaatggatgcgattaacagcgttacctga

DBGET integrated database retrieval system