KEGG   Prochlorococcus marinus NATL2A: PMN2A_1747Help
Entry
PMN2A_1747        CDS       T00267                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pmn00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pmn00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
412655..414184
Genome map
AA seq 509 aa AA seqDB search
MSRYLHTLLKAIDLQVRSGLANPEIKNLSTDSREIEKGDLFLGLDGEKVDGGNFWAKAIE
RGACAAIISKKASLLNPPTNEDPVVILPEPVSLFMGKLAADFWGKPSSEICLIGITGTNG
KTTTSFLIEFLTTSLGHPSALFGTLINRWPNHEETSKYTTTFAVPLQAKLRKAVQAGVEY
GAMEVSSHALSQNRVAGCDFNGAVFTNLSRDHLDYHDSMESYFEAKASLFRSHLIEDGGP
RSVINIDDKWGAKLAKELNKKCWTCSLKENSQTREKADLYISNLQIMQDGYKGKLHTPFG
VENFISPLIGEFNLMNMLQAVGILVQRGLPLNDLLAALNKFPGVPGRMQLINMDGFKVKE
GYPLVIVDYAHTPDGLQNALIASRSLTKRRLICVFGCGGDRDKGKRSKMGEVAAKFADYI
VVTSDNPRQEDPIEIIKDIGKGITIDSEISVEPERSIAIQLAIAKAKKNDVVLIAGKGHE
DYQILKDQTIYFDDREQARKALSLKTDFI
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgcgttatctgcacactttgttgaaagcaattgatcttcaggtccgctcagggtta
gcaaatccagaaataaaaaatctttccactgattctagagaaatcgaaaaaggtgatttg
ttcttaggtttagacggtgaaaaagttgatggagggaacttttgggcaaaagcaattgag
agaggtgcttgtgcagccattattagtaaaaaggcttctcttttaaatccgccaactaac
gaagaccccgtagttattctcccagagccagtatcactatttatgggtaaattagctgca
gatttttggggtaagccatctagtgagatttgtttgataggtattactgggactaacggt
aaaacgactacatcatttttaattgaatttctgactacttcgcttggtcatccatccgct
ttgtttggaacattaattaatagatggcctaaccatgaggaaacttcaaaatatacaact
acttttgcggtccctttgcaggcaaaacttaggaaagccgttcaggcaggagttgaatat
ggagcaatggaagtaagttcacatgctttgtctcagaatagagttgctggttgtgatttt
aatggggcagtatttacaaacctttcaagagatcatttagattatcacgattcaatggaa
tcttattttgaggctaaagctagtttgttccgatcacatctgatcgaagatggtggccct
agatcagtaattaatatagacgataaatggggtgcaaaattagcaaaagagctcaacaaa
aaatgttggacatgttcattaaaagagaactcccaaaccagagagaaagcagatttatat
ataagtaatcttcaaattatgcaagacggatacaaggggaaattgcatacgccctttggg
gttgaaaattttatttcaccactaataggtgagtttaatttaatgaatatgttgcaagca
gtaggaattttagttcaaaggggactcccattaaatgatcttttggcagctttgaacaag
ttccctggagtgccagggagaatgcaactgattaacatggatggatttaaagtaaaagag
ggctatccactagtgatagtagattatgcgcatacaccggatggtttgcaaaacgcttta
atcgcatcgagatcattgacgaaaagaagattaatttgtgtctttggttgtggtggtgat
agagataaaggtaaaagatctaagatgggggaagttgctgctaagtttgcagattatata
gttgtgacatctgataatcctcgacaagaagacccaatcgaaattattaaagatattgga
aaaggtataacaattgattctgagatttctgttgagccagagagatccattgcaatccaa
ttggctatagcaaaagccaagaaaaacgacgttgttttaatagcagggaaaggtcatgag
gattatcaaattctaaaagatcagacaatttattttgacgatcgtgaacaagctagaaaa
gcattatctttaaaaacagattttatttga

DBGET integrated database retrieval system