KEGG   Prochlorococcus marinus NATL2A: PMN2A_1799Help
Entry
PMN2A_1799        CDS       T00267                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pmn  Prochlorococcus marinus NATL2A
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pmn00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
463012..463572
Genome map
AA seq 186 aa AA seqDB search
MSSLGNLTVLTGPSGVGKGTIVRKILESHSDVWLSISATTRQPRSGEIDGEHYFFLEKKQ
FQEIIDKDGFLEWASFSNNFYGTPKKIVKEKIEKGTNVLLEIELEGARQIRKSFPEAFQI
FLAPPNLYELEKRIRGRGTETEESIRDRLSIAEKELIAQKEFDAVVINEDIEKAFKEIEG
FMGLKL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctttaggaaatcttactgttcttactggccctagcggggtgggtaaaggaaca
attgttaggaaaatcctcgaaagtcatagtgatgtatggctttctatttctgctactact
cgtcagccaagatctggagaaattgacggagagcattatttcttcttagagaaaaaacaa
tttcaagaaataattgataaagatggtttccttgagtgggcttcattctctaataatttt
tatggaactccaaaaaaaatagttaaagaaaagattgaaaagggaactaatgttcttctt
gaaattgaactagagggtgctcgacaaattcgaaagtcttttccggaggcatttcaaata
tttttagcaccaccaaatttatatgaacttgaaaaaagaattagaggaagaggaactgaa
acagaagaatctattagagatcgtttgtccatagctgagaaagaacttattgcccaaaaa
gagtttgacgctgtagttattaatgaagatatagaaaaagccttcaaggaaattgaaggc
tttatgggattaaaactttaa

DBGET integrated database retrieval system