KEGG   Petrotoga mobilis: Pmob_0026Help
Entry
Pmob_0026         CDS       T00621                                 

Definition
dihydrofolate reductase region
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pmo  Petrotoga mobilis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pmob_0026
   00670 One carbon pool by folate
    Pmob_0026
Enzymes [BR:pmo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Pmob_0026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(22873..23403)
Genome map
AA seq 176 aa AA seqDB search
MRVKLIMVQSINGKIRMSDDSQRSWSSAEDKEHFYNITKDIGIILMGRKTFEEIGSPLKN
RINIVLTGNPEKYKEVELKYDKYLYFTDNPPEILLDKLEKKGYPEVALIGGSTINSLFLE
KNLIDEIFLTIEPVIIEGDLSIFKYVNDKYNFKLTDFKKLNEDTILLHYLKTDDKK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaaagttaattatggttcaaagtatcaatggaaaaatccgaatgtcagatgat
tctcagagaagttggtcctcagcagaagataaggaacatttctataatataaccaaagat
attggcataatacttatggggagaaaaacatttgaagagataggatctcctttaaaaaat
agaattaatattgtgttgacaggaaatcctgaaaaatataaagaagttgagttaaaatat
gacaaatatctctattttacagataatcctccagagatattgttggataaactagagaag
aaaggataccctgaagttgcattaataggtggttctacgataaactccttgtttttagag
aaaaatttaattgatgaaatctttctaactatcgaaccagtaattattgaaggtgatcta
tcgattttcaaatacgtgaatgataaatataatttcaagctgactgattttaaaaaatta
aatgaagatactattcttttgcattacctgaaaactgacgataaaaaatag

DBGET integrated database retrieval system