KEGG   Petrotoga mobilis: Pmob_0100Help
Entry
Pmob_0100         CDS       T00621                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pmo  Petrotoga mobilis
Pathway
pmo00230  Purine metabolism
pmo01100  Metabolic pathways
Module
pmo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pmob_0100
Enzymes [BR:pmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Pmob_0100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 MMR_HSR1 AAA_22 AAA_29 AAA_16 NTPase_1 RsgA_GTPase ABC_tran dNK cobW Viral_helicase1 RNA_helicase AAA Zeta_toxin AAA_14 AAA_30 T2SSE
Motif
Other DBs
NCBI-ProteinID: ABX30849
JGI: Pmob0100
UniProt: A9BEX1
Position
97757..98365
Genome map
AA seq 202 aa AA seqDB search
MEGLLYIVSGPSGAGKSTLIKNVLDKIIGFSFSVSYTTREKRPGEIDGKDYFFVDKSTFF
KMKEDGEFLEWAEVHGNYYATSKKFIEEKLKESRGLVLDVDVQGALNIKKIYKNAIYIFI
LPPSNEDLEKRLKKRGTESKDSLEIRLKDAQWEISHMKDFDYVIVNQEIEESTNQLISVL
VAEQLKRERFDDKTPFFFKKQL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggagggtttactttacatcgttagtggaccatcaggtgcaggaaaatctacattgata
aaaaatgttttagacaaaattattggcttttcattttctgtttcctataccacaagagaa
aaaagaccaggagagattgacggaaaagattatttttttgttgataaaagcacctttttt
aaaatgaaagaagatggagaatttctcgagtgggctgaggttcatggaaattattatgca
acttccaaaaaatttattgaggaaaagttaaaagaaagtcgaggccttgttttagatgtc
gatgttcaaggagctttaaatattaaaaaaatttataagaacgccatatacatttttatt
ttacctccctcaaatgaggatctagaaaaaagactaaaaaaaaggggtaccgaatcaaaa
gattctttggaaataaggctaaaagatgcacagtgggagatttctcatatgaaagatttc
gattacgttattgtcaaccaggaaattgaagaatcaacaaatcaactcatatcagttctc
gtggcagaacaacttaagagagaaaggttcgatgacaaaactccgtttttttttaaaaaa
caactatga

DBGET integrated database retrieval system