KEGG   Petrotoga mobilis: Pmob_0119Help
Entry
Pmob_0119         CDS       T00621                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
pmo  Petrotoga mobilis
Brite
Enzymes [BR:pmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Pmob_0119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
117314..118090
Genome map
AA seq 258 aa AA seqDB search
MNFFDNIPPSTSVSPISKELYLKNDSNIAVLILHGYTGSPHDMYYIGRQIHKSGFSIYIP
RLPGHGTNSNDFLNSNWRDWLRKSIDSYINLKTYHEKVYILGLSMGGVIATLLASKFHPE
KIVLAAPALKAKDWRINLTPFFGLIVKKIKRKNPQTFDDEKLAYLASQYWNYDWPSKAAD
LYKLQKMALKNLSKVTSNTYVILSKKDEAVPFSVKEIIENNIKGKTEFLILEESGHVVVN
DIEKEKVAEQTINWLKKE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgaatttcttcgataacataccaccaagcacatctgtttcaccaatatcaaaggagctt
tatttaaaaaatgattcaaatattgcggtattgattctacatggttacacgggttctcct
catgatatgtactacataggtagacagattcacaaatctggtttttctatatacatacct
cgactccccgggcacggaaccaattccaacgattttttaaactctaattggagagattgg
ctgagaaaatctatagactcttatattaatttaaaaacctaccatgaaaaagtctacatt
ttaggcctttctatgggtggtgtaatagcaactctcttagcaagtaaatttcatccagaa
aaaattgtcttagctgctcctgcactaaaagcaaaagattggagaataaatttaactcca
ttctttggccttatcgttaagaaaataaaaagaaaaaatcctcagacattcgatgacgaa
aagcttgcttatctagctagccaatactggaattatgactggccttcaaaggcagctgat
ctttacaaactgcaaaaaatggctcttaaaaacctttcaaaagtcacatctaacacttat
gtgatactttcaaaaaaagacgaagccgttcctttttcggtaaaggaaattatagaaaat
aatattaaaggaaaaaccgaatttctgatattagaagaaagcgggcacgtagttgtaaac
gatatcgaaaaagaaaaagtggcagaacagactataaattggcttaaaaaagaatag

DBGET integrated database retrieval system