KEGG   Petrotoga mobilis: Pmob_0310Help
Entry
Pmob_0310         CDS       T00621                                 

Definition
RluA family pseudouridine synthase (EC:3.2.1.17)
Orthology
K06179  
23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24]
Organism
pmo  Petrotoga mobilis
Brite
Enzymes [BR:pmo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.24  23S rRNA pseudouridine955/2504/2580 synthase
     Pmob_0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
332565..333476
Genome map
AA seq 303 aa AA seqDB search
MEKETTVNEKNYYSRLDTFIRKNYPEIKLGAIYGLIRKGFVKVNEKRVKKNNYILEIGDN
VKIILDENKLEELSRPTQPSLKARPVSFDIIYEDKDLLVINKPAKVSVHPGSKEEMATII
EGVMHYSRGEFEPHLVHRLDKLTSGVMVVAKNKQTARELTQLIKSRETRKYYLTLLVGNL
NKKSGELVSTVYGKTAQLKFNLKKKFDLFGELYSLVEIELYTGRKHQIRVQFADLGFPIA
GDDNHGDKKQNKLLRKNYGLKRIFLHASKISFDYNNKHYDFYAPLSEDLQTVLDKLEKSP
KRN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaagaaacaacagtgaacgaaaaaaattattattctaggttagacacgtttata
agaaaaaattatcccgaaataaaattgggagctatttatggtttgataagaaaaggtttt
gttaaagtcaatgaaaagagggtcaaaaagaacaattatatcttagaaataggagacaac
gttaaaattattctggatgaaaataaattagaagaattatccagacctactcaaccttct
ttaaaggcaagaccagtctcttttgacattatctatgaagataaagaccttctagtgata
aacaaacctgccaaagtgtctgtacatccgggttctaaagaagaaatggcaacgataatc
gaaggagtgatgcattactcacgaggtgaatttgagcctcacttggtacatcgtttagat
aaattaacatctggggtaatggttgtggcaaaaaacaagcaaacagctcgtgagttaaca
cagttaatcaaaagtagagaaacaaggaaatactacttaaccttattggtagggaattta
aataaaaaaagtggagaattagtttctacagtttatggtaaaacagcacagttaaaattt
aaccttaagaaaaaattcgatttatttggtgagctatattctttggtagagattgaatta
tacacaggcagaaaacatcaaataagagttcaattcgctgatttaggttttcccatcgct
ggggatgataatcacggggataaaaagcagaataagcttttaagaaaaaattatggttta
aaaagaatttttcttcatgcgagtaagatttcttttgattataataataagcattacgat
ttttatgcaccgctgagtgaagatcttcaaactgtattggacaaactggagaaaagccca
aagaggaattga

DBGET integrated database retrieval system