KEGG   Petrotoga mobilis: Pmob_0466Help
Entry
Pmob_0466         CDS       T00621                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pmo  Petrotoga mobilis
Pathway
pmo00010  Glycolysis / Gluconeogenesis
pmo00052  Galactose metabolism
pmo00500  Starch and sucrose metabolism
pmo00520  Amino sugar and nucleotide sugar metabolism
pmo00521  Streptomycin biosynthesis
pmo01100  Metabolic pathways
pmo01110  Biosynthesis of secondary metabolites
pmo01120  Microbial metabolism in diverse environments
pmo01130  Biosynthesis of antibiotics
pmo01200  Carbon metabolism
Module
pmo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmob_0466
   00052 Galactose metabolism
    Pmob_0466
   00500 Starch and sucrose metabolism
    Pmob_0466
   00520 Amino sugar and nucleotide sugar metabolism
    Pmob_0466
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pmob_0466
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Pmob_0466
Enzymes [BR:pmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pmob_0466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase Hydant_A_N FGGY_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: ABX31202
JGI: Pmob0466
UniProt: A9BFN2
Position
complement(503436..504377)
Genome map
AA seq 313 aa AA seqDB search
MSNWIGIDIGGTKILGTLFDEKGNKLKTEKKSSKSSKGKEKVVEQLKKVLDSLLTENKDV
KGIGIGVPGVIKDGKITFTPNMPLNEFNVVDFVEQEYNIKTIIENDANASMYGEWKFGAA
KGAKNAVGYFVGTGIGGGLILNESLYKGSFNFAAEIGHMNVYPEGPLCGCNLRGCLESLS
SKVAIQREIVRKKERGEKTLIKNSDLKGIVKSSTLKAAYDQRDDLIRNILNDAARYIGIN
AGSIINLLNPEVIVLGGGVMEALGEQLMPIVVETAKQYSIPHIFECCEFKLSQLLDDACL
YGAFSLVKEKVGV
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattggattgggatagacatagggggaactaaaatactcgggactttattcgat
gagaaaggtaacaaattgaagacggaaaaaaagagttccaaaagttcaaaaggcaaagaa
aaagttgtcgaacaattgaagaaagttttagattccctgctgacagaaaataaagatgta
aaagggatagggataggggtaccgggggttataaaagatggaaaaattacctttactcct
aacatgcctttgaatgaatttaatgtagtcgattttgttgagcaagagtacaacatcaaa
actattatagaaaatgatgccaatgcgagtatgtatggggaatggaagtttggtgccgct
aaaggagcaaaaaatgccgtaggttattttgtaggaactggaattggaggcggtttaata
ttgaatgaatcattatataaaggttcattcaattttgctgctgagattggacacatgaat
gtgtaccctgaaggacctctttgcggttgtaatcttcgtggctgtttggaaagtttgtct
tctaaagtagctatccaaagagaaatagttagaaaaaaagagagaggcgaaaagacctta
ataaaaaatagtgatttgaaaggcatagtgaaaagttctactttaaaagctgcttatgat
caaagggacgatctaataagaaatatcttaaacgacgccgcaaggtatataggaataaat
gctggttccatcattaatttattaaatcctgaagttatcgttttaggagggggagtaatg
gaggctttaggagaacaattgatgcctatagtagttgaaacagccaagcagtactctata
cctcatatcttcgagtgttgtgagtttaaactatcacaattgctagatgatgcatgcttg
tatggggctttttcgcttgttaaagaaaaagtaggtgtataa

DBGET integrated database retrieval system