KEGG   Petrotoga mobilis: Pmob_0466Help
Entry
Pmob_0466         CDS       T00621                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pmo  Petrotoga mobilis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pmob_0466
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmob_0466
   00052 Galactose metabolism
    Pmob_0466
   00500 Starch and sucrose metabolism
    Pmob_0466
   00520 Amino sugar and nucleotide sugar metabolism
    Pmob_0466
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pmob_0466
   00524 Butirosin and neomycin biosynthesis
    Pmob_0466
Enzymes [BR:pmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pmob_0466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(503436..504377)
Genome map
AA seq 313 aa AA seqDB search
MSNWIGIDIGGTKILGTLFDEKGNKLKTEKKSSKSSKGKEKVVEQLKKVLDSLLTENKDV
KGIGIGVPGVIKDGKITFTPNMPLNEFNVVDFVEQEYNIKTIIENDANASMYGEWKFGAA
KGAKNAVGYFVGTGIGGGLILNESLYKGSFNFAAEIGHMNVYPEGPLCGCNLRGCLESLS
SKVAIQREIVRKKERGEKTLIKNSDLKGIVKSSTLKAAYDQRDDLIRNILNDAARYIGIN
AGSIINLLNPEVIVLGGGVMEALGEQLMPIVVETAKQYSIPHIFECCEFKLSQLLDDACL
YGAFSLVKEKVGV
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattggattgggatagacatagggggaactaaaatactcgggactttattcgat
gagaaaggtaacaaattgaagacggaaaaaaagagttccaaaagttcaaaaggcaaagaa
aaagttgtcgaacaattgaagaaagttttagattccctgctgacagaaaataaagatgta
aaagggatagggataggggtaccgggggttataaaagatggaaaaattacctttactcct
aacatgcctttgaatgaatttaatgtagtcgattttgttgagcaagagtacaacatcaaa
actattatagaaaatgatgccaatgcgagtatgtatggggaatggaagtttggtgccgct
aaaggagcaaaaaatgccgtaggttattttgtaggaactggaattggaggcggtttaata
ttgaatgaatcattatataaaggttcattcaattttgctgctgagattggacacatgaat
gtgtaccctgaaggacctctttgcggttgtaatcttcgtggctgtttggaaagtttgtct
tctaaagtagctatccaaagagaaatagttagaaaaaaagagagaggcgaaaagacctta
ataaaaaatagtgatttgaaaggcatagtgaaaagttctactttaaaagctgcttatgat
caaagggacgatctaataagaaatatcttaaacgacgccgcaaggtatataggaataaat
gctggttccatcattaatttattaaatcctgaagttatcgttttaggagggggagtaatg
gaggctttaggagaacaattgatgcctatagtagttgaaacagccaagcagtactctata
cctcatatcttcgagtgttgtgagtttaaactatcacaattgctagatgatgcatgcttg
tatggggctttttcgcttgttaaagaaaaagtaggtgtataa

DBGET integrated database retrieval system