KEGG   Petrotoga mobilis: Pmob_0484Help
Entry
Pmob_0484         CDS       T00621                                 

Definition
glycoside hydrolase family 3 protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pmo  Petrotoga mobilis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pmob_0484
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Pmob_0484
Enzymes [BR:pmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Pmob_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
523713..525299
Genome map
AA seq 528 aa AA seqDB search
MESLEKALGKLFLIGIQGTSLNNENMKVLKSTLPGVIIFFSRNIENKYQLSKFIEDIKNF
LDYEPLFCIDQEGGTVARLKKGFTVVPSAMGITATNEAENAYLSANLLAKEMLAVGIDWN
LAPVVDINNNPKNSVIGIRSFSDDKNVVLKFAREYVKGLHDGGVLSCLKHFPGIGNVNTD
PHLDLPQGELSKDDLLSTELFPFLNIDSPSWMPTHVYLSKIQNKKEPASLSEEILTGLAR
EELKYKGVLVADDFEMGGVANFYSAQEAVIKSLNAGMDIVSICHSFEKQSAAKNAVLREY
KNNENFKKKINSSLERIQSLMKISADLREKNNNKISLEEIGKKEYINLAKNIFDKSITVL
NMSHDKSFLPLKNVDEIYYFAKESLSYGIEDKRTQISYIIEPISKELKAKVNILETSKII
DPLVREEIIQNSKNKTILVLAENAYLHSELVDLISNMSQKSKKLILVALRNPYDVFIPKV
KYGICTYGFNENIQTSLLKILKGEIKPTGNLPIKRRLENARESGNRKK
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtttagagaaggctttggggaaactattcttaatagggattcaaggaacctct
ttaaacaacgaaaatatgaaggttttaaaatcaactttgcctggggttatcattttcttt
tcacgaaacatagaaaacaaatatcaacttagcaagtttatcgaagatattaaaaatttt
ttagattacgaacccttattttgtatcgatcaagaaggtggaacggtagcaagattaaaa
aaaggatttactgttgtacccagcgctatgggtataactgcgactaacgaagcagagaat
gcatatctttctgcaaatttacttgcaaaagaaatgttagcagttggaatcgattggaat
cttgctccagttgttgatatcaacaacaacccaaagaattctgtaattggaattagaagt
ttttccgatgataaaaatgtggtactaaagtttgcccgtgaatatgtgaagggattgcat
gacgggggagtactttcttgtctaaaacatttccctggtattgggaacgtcaacaccgat
cctcatttagaccttccccaaggcgaattaagcaaagatgatcttctttcaacagagtta
ttcccgtttctaaatattgattctccttcatggatgccgactcatgtgtacctttccaag
atacaaaataaaaaagaaccagcatctttatcagaagagattttaacaggattggcaagg
gaagaactaaaatataaaggagttttggttgcggatgattttgagatggggggagtagca
aacttttattcagcccaagaggcagtaataaaatcactgaatgccggaatggacatagtt
agtatctgccattcttttgaaaaacaatcagcagccaaaaacgctgtattgagagagtat
aaaaataacgaaaattttaaaaagaagataaattcatcactagagagaatccaatcgtta
atgaaaatttcagcagatttgagggagaaaaacaataataaaatatcactagaagaaatt
ggcaaaaaagaatatataaacttagctaaaaatatttttgataaatctatcactgttctt
aatatgtctcatgacaaaagctttttgcctttaaaaaacgttgatgaaatttattacttt
gctaaagagtcattatcttacggaatcgaagacaaaagaacacaaatttcttatattatt
gagccaatatcaaaagaactcaaagcaaaagtaaacattttagaaacgagtaaaataatt
gaccctctggtaagggaagaaataattcaaaactctaaaaacaaaactatcttggttcta
gctgaaaatgcatatttgcattcagaattggttgatttgataagtaacatgtcccaaaaa
tcaaaaaaactaattttagttgctttaagaaacccatatgacgtatttattcctaaagta
aagtacggaatttgcacatacggttttaatgaaaatattcaaacttctttgcttaaaatt
ctcaaaggagaaataaaaccaactgggaatttaccaattaaacggaggctagaaaatgct
agagaatctggaaaccgaaaaaagtaa

DBGET integrated database retrieval system