KEGG   Petrotoga mobilis: Pmob_0584Help
Entry
Pmob_0584         CDS       T00621                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
pmo  Petrotoga mobilis
Pathway
pmo00010  Glycolysis / Gluconeogenesis
pmo00020  Citrate cycle (TCA cycle)
pmo00620  Pyruvate metabolism
pmo00640  Propanoate metabolism
pmo00650  Butanoate metabolism
pmo00680  Methane metabolism
pmo01100  Metabolic pathways
pmo01120  Microbial metabolism in diverse environments
pmo01130  Biosynthesis of antibiotics
pmo01200  Carbon metabolism
Module
pmo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmob_0584
   00020 Citrate cycle (TCA cycle)
    Pmob_0584
   00620 Pyruvate metabolism
    Pmob_0584
   00640 Propanoate metabolism
    Pmob_0584
   00650 Butanoate metabolism
    Pmob_0584
  Energy metabolism
   00680 Methane metabolism
    Pmob_0584
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pmob_0584
Enzymes [BR:pmo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pmob_0584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C MCR_C
Motif
Other DBs
NCBI-ProteinID: ABX31318
JGI: Pmob0584
UniProt: A9BH88
Position
complement(636161..637138)
Genome map
AA seq 325 aa AA seqDB search
MPNIRDIVGYVETHDWSFTQGHRLCPGCNAPMVANWATLAAKSLGYEPVVAAATGCLEVS
STIYPFTSWNVPYIHNAFENVAATISGAEAAYRSLLNRGKINNDKIKFIAFAGDGGTYDI
GLQSLSGAIERGHDFVYILYDNEGYMNTGNQRSGSTPVGADSTTAPVGKSISGKLQLKKS
IVDIVAGHEGVYAATAVTAEPWDFMRKMQTALEFKGPSFIAMLAPCVRFWRIPDDSGPEV
TKLAVETKYWPLWEYNMGVYRVTKKPKTFKPVKDYITKLGRYSKLMKRPDANEILEELQN
YVDAKWDRLLALEEMTKDKPLRTKI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgcctaatattagagatatagtaggatacgttgaaacacatgattggtcttttacacaa
ggacatagattatgcccagggtgtaatgctccgatggttgcaaattgggctactttggcc
gcaaaaagtttgggttatgaacctgtagtggcagctgccacaggttgtttggaagtttct
tccacaatatacccatttacttcttggaatgtaccttatatacacaatgcctttgaaaat
gttgctgcaacaatctctggggcagaagccgcttacagatctctattaaacagagggaaa
attaacaacgataagataaaatttatcgcatttgctggtgatggcggcacttacgatata
ggtttacaatctttatctggagctatagaaagaggacacgattttgtttacattttgtat
gataacgaaggttacatgaacacaggtaaccaaagatctgggtccactcctgtgggtgcc
gattcaacaactgctccagtaggtaaatctatatcagggaagttacaattgaaaaagagt
atagttgatatagtagccggtcatgaaggtgtttatgccgcaaccgcagtaacggctgaa
ccttgggattttatgagaaagatgcaaacagcattagagttcaaaggaccttctttcatt
gctatgctggcaccatgtgtaagattttggagaattcctgacgattcaggtccagaagta
actaaattagctgtcgaaacaaagtattggccattatgggaatacaatatgggtgtttat
agggttactaagaagccaaaaacattcaaaccagtaaaagattacataactaaattggga
agatacagtaaacttatgaaaagaccagatgcaaacgaaatactggaagaactacaaaat
tatgtagatgctaaatgggataggttgttggctttagaagaaatgactaaagataaacct
cttagaacaaaaatatag

DBGET integrated database retrieval system