KEGG   Petrotoga mobilis: Pmob_0642Help
Entry
Pmob_0642         CDS       T00621                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pmo  Petrotoga mobilis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Pmob_0642
Enzymes [BR:pmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Pmob_0642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
692861..693508
Genome map
AA seq 215 aa AA seqDB search
MLLAEERKMIAEYGKKLIDSGLTTGTGGNISIFNRDQQLMAITPSGVPYHNISPEDVAVL
DLNNNILDSNKKPSSEYEMHKIFYEKRKNVTAVVHTHSVYATTIACLNWELPAVHYLIGY
AGSKVPLAKYATFGTKELAKNAYQAMGNYNAVLLANHGLLAVGKDIDWAFNTAEEIEFTC
QIYYQTKTIGEPVILSSEEMKKIMEKFDSYGQIQK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgttactagctgaagaaaggaaaatgatagcagaatatggtaagaaacttattgattca
ggcttgactactggaactggtggcaatataagtatttttaatcgtgatcaacaattaatg
gctataactccttcaggtgttccctatcataatatttcaccagaagatgtggcagttctg
gatttaaataataacattctagatagcaacaaaaaaccttctagtgaatacgaaatgcac
aaaatattttatgaaaagaggaaaaatgttactgcagttgtacatactcattcggtttat
gcaactactattgcttgcttgaattgggaattaccagctgttcattatctcattggttat
gctgggagtaaggttccgttagcaaaatatgccacctttggaacaaaagagttagcaaaa
aacgcttatcaagctatgggaaattataatgccgttttattagcaaatcatgggctttta
gcagtaggaaaggatatagattgggcttttaatactgcagaggaaatagaatttacttgt
cagatttattatcagactaaaactattggtgaacccgttattttatcttctgaagaaatg
aaaaaaatcatggaaaaatttgatagctacggtcagatacaaaaatag

DBGET integrated database retrieval system