KEGG   Petrotoga mobilis: Pmob_0977Help
Entry
Pmob_0977         CDS       T00621                                 

Gene name
pyrB
Definition
bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit (EC:2.1.3.2)
Orthology
K00608  
aspartate carbamoyltransferase [EC:2.1.3.2]
Organism
pmo  Petrotoga mobilis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Pmob_0977 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pmob_0977 (pyrB)
Enzymes [BR:pmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Pmob_0977 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1037580..1039157)
Genome map
AA seq 525 aa AA seqDB search
MKNDFLGRSLTVMNDLTVEEQLFLYNQTKRLKAKWANKEDLTEFQIKNQTGIYIVFLESS
TRTKESFINASKFHKNAKINIFESEHSSFNKNESYIDTFNMLTGYSDYSIFIIRSKLEGT
CKLLDEKVSEFASRHNLPHPSFINAGDGKHEHPTQEILDEFTFLEQMDFNNEYIHIALIG
DLLHGRTVHSKVEGLKIFKNVEVDLIAPEELQMPKHYISKMKLKGYNVRIFSSIEEYLKQ
SKKANIWYFTRLQLERMGEDILEKEHILRKSVTFTKEFLPLISENVKFYHPLPRHKTYPT
IPTFLDPLPLNGWEKQAINGYWTRIILLSMLGGALTAPFDTSRKNLEINEEDFIIPAPIK
DGKKGLLSEGKRGIKPIENGTVIDHIAKGQKSEKIYETIMKIRKILKFYNIDSADGIFRS
ADGRLKGYISLPDVHLSKKEIKKLSAISPNTTVNIIEGGRVKEKYRISLPPIIYGFEELR
CKNENCITNPQNNENVQVSFIRNEENELICEYCETPHTFEEIWRF
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgattttttagggagaagtttaacggttatgaatgatttaacggttgaagag
cagttatttctttacaaccaaacaaaaaggctaaaagcaaaatgggcaaataaagaagat
cttactgagtttcaaataaaaaatcaaacaggtatttatatagtattcctcgaatcaagt
accagaaccaaagaatccttcattaatgcttctaaattccacaaaaacgctaaaatcaac
atcttcgaatcagaacactcctcgtttaataaaaatgaaagttatatagataccttcaat
atgttaacgggctattcggattattctatattcattatcagatcaaaactggaaggtact
tgcaagttattagacgaaaaggtatcagaatttgcttcaaggcataacctaccacatcct
tcttttataaatgccggagatggtaagcacgagcatcctactcaagagattttagatgaa
ttcacatttttagaacagatggatttcaacaacgagtacattcatatagcccttattggg
gatctccttcatggaagaacggtccattccaaagtggaaggtttaaaaatatttaaaaat
gttgaggttgatttgatagcgccagaagaattacagatgccaaaacactatataagcaaa
atgaagctaaaagggtacaacgttagaatcttctcttcaatagaagagtacctaaaacag
agtaaaaaagcgaacatttggtatttcacaaggcttcaattagaacgaatgggtgaagat
attctagaaaaagaacatattttgagaaaaagtgtgacttttacaaaagaatttctcccc
cttatttccgaaaacgtaaaattttatcaccccctccctcgtcataaaacttaccccact
attccaacctttttagaccccttaccgcttaacggctgggaaaaacaggcaataaacgga
tattggacaaggataatcttactttctatgttaggtggagctttaaccgccccctttgat
acctcaagaaaaaatcttgaaattaatgaagaggatttcatcatacccgctccgataaag
gatggtaaaaaagggttgttgagtgaaggaaaaagagggatcaagccaattgaaaatggg
acggtaatagatcacatagccaaagggcaaaagtcggaaaagatatatgagactatcatg
aagataaggaagattttgaagttttataatattgatagtgcagacggaatatttagatca
gccgatggtagattaaagggttatattagtttgcccgacgttcatctatcaaagaaagaa
ataaaaaagctttcagctatatctccaaacacaactgtgaatattattgaaggtggaaga
gtaaaagaaaaatacagaatttctttaccgcctattatatacggtttcgaagagttaagg
tgtaaaaatgaaaactgtataaccaaccctcaaaacaacgaaaacgtacaggtctctttc
attagaaatgaggagaatgagttaatatgtgaatattgtgaaacccctcatacctttgaa
gaaatatggcgcttttaa

DBGET integrated database retrieval system