KEGG   Petrotoga mobilis: Pmob_1017Help
Entry
Pmob_1017         CDS       T00621                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pmo  Petrotoga mobilis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pmo01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pmo00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1084686..1085813
Genome map
AA seq 375 aa AA seqDB search
MELQSYVSQILNDIKNNGMLAVKKYSKQFDNYDGDLELKVEEWDIDEVIPAQDKEIIERT
IQRLENYHIKQKTEDIMYSNEYNSTYGLINRPINRIGIYVPGGKPLPSSLLMVAIPAKIA
GVKEMLITSSPKDGLINPYIIYIAKKLGIKEIYKIGGIQAIAAMTYGIGMKKVDKIFGPG
NQYVNEAKRQVFGEVGIDSLAGPSEICVIADETAKPEYILNDLLSQLEHGYESKAFLVTT
SKELYEYCEREGIDRHLFKSIEDCAAKTNEIAPEHLEIMTKDPESVLPLIQNAGAVYLGD
YTPVPAADYFLGVNHVLPTGGAARFSSVLNLSDFTKKISIAKVSKEELLKERYLGIRMAE
IEGMYQHKKSMEVRK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaattacagagctacgtttcacagatattaaacgacattaaaaacaacggaatgctt
gcagtaaaaaagtattcaaaacagttcgataattatgatggtgatttagaattaaaagtt
gaagaatgggatattgacgaagtaatccccgcgcaagataaagaaattatagaaagaacg
attcaaaggttagagaattaccatataaaacaaaaaacagaagatattatgtattcaaat
gaatacaactcaacttatggactgattaatagaccaataaacaggatagggatctatgtt
ccaggaggtaaacccttaccttcgagtttgttgatggtagctattcccgccaagattgca
ggggtaaaagaaatgttgatcacttcctctccaaaagatgggttaataaacccttacatt
atctatatagcaaaaaagttagggataaaagaaatttacaaaattggtggaattcaagca
atagccgctatgacatacggcatcggcatgaagaaagtagataaaatatttggtcctggg
aaccaatatgtgaatgaagcaaaacgacaggtgtttggagaagtcgggatagacagtttg
gcaggaccatcagaaatctgtgtgatagctgatgagacagcaaaaccagaatacattcta
aacgacttgctctcccaacttgaacatggttatgaatctaaagctttcttggtcactaca
tcaaaagaattatacgaatattgtgaaagagaagggatagatagacaccttttcaaaagt
atagaagattgtgcagctaaaaccaacgaaatagcgcctgagcatttagagataatgaca
aaagatcctgaatcagtactacctctcatacaaaatgctggagctgtttatttgggagat
tacacgccggtaccggcggcggattatttcttaggtgttaaccacgtactgccaacaggt
ggtgcagcacgtttctcctccgttttgaacctatcagattttacaaaaaaaatatccatc
gcaaaagtgagtaaagaagaattgttaaaagagagatacttaggtataagaatggcggaa
atcgaaggtatgtaccaacacaaaaaatctatggaggtgaggaaatga

DBGET integrated database retrieval system