KEGG   Petrotoga mobilis: Pmob_1103Help
Entry
Pmob_1103         CDS       T00621                                 

Definition
diaminopimelate aminotransferase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pmo  Petrotoga mobilis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pmob_1103
  Amino acid metabolism
   00300 Lysine biosynthesis
    Pmob_1103
Enzymes [BR:pmo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Pmob_1103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1182268..1183491
Genome map
AA seq 407 aa AA seqDB search
MKESIIKKVEELKEEIIESSKKFISIDSVNPRAGGPGEKEAAEWLESLIKGWNFDEIKRY
DAPDDAVEYGYRPNIVATYKGQNPQRTIWFVTHMDKVPAGDIKLWETDPFQPVVKDGKIF
GRGSEDNGASLISTLYAVKSIMDLKVRPKNNIALALVSDEETGSEFGIKYLLKQGLFKEG
DWFYVPDAGESDGSFIEVAEKSIMWLKITTIGKQGHASMPNISINAHRAGMDFAIAADKY
FHENYNLQDDLFNYPYSSFEPTKKVSNVENINTIPGTDIIYFDGRILPNYDVEQIINNLK
NLSKEYENKWNVKIIIEGEHIEKSTKPTPKDHPCVEMLKESIRDLRNIEAEVGGIGGGTC
AAIVRGAGFPAAVWSTIDGTAHQPNEYVKIDNLIKDTQVFAYLMNNL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaagtataattaaaaaagtagaagaattaaaagaagaaattattgaaagttca
aaaaagttcatatcaattgactctgtcaacccacgtgcgggaggacctggagaaaaggaa
gctgcagaatggctggaatctttgattaaaggctggaattttgatgaaattaaaagatac
gacgctccagacgatgctgttgaatatggatacaggccaaacattgttgcaacctataaa
ggtcaaaatccacaaagaactatttggtttgtaacgcacatggacaaggtacctgctggt
gatatcaaattgtgggaaacagatccttttcaaccggtagtaaaagacggaaagattttt
ggaaggggaagcgaagacaatggagcctctttaatatcaacattatatgccgtgaaaagt
attatggatttaaaagtgaggccaaaaaacaacattgccttagctttggtttcagatgaa
gaaacgggttcagaatttggaataaaatacttattaaaacaaggattatttaaagaaggg
gattggttctacgtaccagatgccggggaatctgatggaagcttcatcgaagttgcggaa
aaatcgattatgtggttaaaaataacaactattggaaaacaaggccatgcatctatgccc
aatatctccattaacgcccatagagctggtatggattttgcaattgcagcggataaatat
ttccacgaaaattataacctacaagacgacctctttaattatccttactcttcttttgaa
ccaacaaagaaagtatcaaatgttgaaaatataaataccattcccggcactgatatcata
tatttcgatggaagaattcttccaaattatgacgttgaacaaataataaacaaccttaaa
aacctgtcaaaagaatacgagaataaatggaatgtcaaaataataattgaaggggaacat
attgaaaaatcaacaaaacccactccaaaagaccacccctgtgtagaaatgttgaaagaa
agtataagggaccttagaaatatagaagctgaagttggtggaataggtggaggtacctgt
gcagcgatagtccgtggggcagggtttcctgctgctgtttggtcaacaattgatggaaca
gcacatcaacctaacgaatacgtgaaaattgacaatttaattaaagatacccaagttttc
gcataccttatgaataatttataa

DBGET integrated database retrieval system