KEGG   Petrotoga mobilis: Pmob_1120Help
Entry
Pmob_1120         CDS       T00621                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
pmo  Petrotoga mobilis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1201829..1202851
Genome map
AA seq 340 aa AA seqDB search
MRKYLKDLTNLAGISSREEKIREYIKSNVANKVDEITEDNMGNLICLIKGKDSSKKLMLD
AHMDEVGFMITRINEDGTFGISPVGGVDPRVVKSQRLKIEEKISAVVNSTPIHLEKETDK
VEQYESIKVYAGFSNKEEASKKVHLGDMVTFDTTYYEENSYAVAKAFDDRVGCSIMMDII
DYFFENNEKPLYDTYFNFATQEETGLRGTGTAASKIQPNFAIVLEGTTAGDNPENTPDKW
ATHIGNGPVLTFMHSGLVLNKEIFEKIVDTAKKLGIKFQYKMRTAGGTNAARLAKTLYGI
PAGVISVPCRYIHSPQSIMNLQDYENTYQLVKQLVVNTPF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagtatttaaaagacttaactaatcttgccggtatatcttcaagagaagaaaaa
ataagagagtacatcaaatcaaatgttgccaacaaggtcgatgaaattaccgaagacaac
atgggaaacctaatttgtttaattaaaggtaaagattcttccaaaaaattaatgcttgac
gcacacatggatgaagttggctttatgatcaccagaataaatgaagacggtacttttggc
atatctcccgttggaggagttgacccaagggtagtaaaaagtcagagattaaaaatcgaa
gaaaaaatatctgctgttgtcaattctacacccattcacttagaaaaagaaaccgacaaa
gttgaacagtatgaaagtataaaggtctacgctggattttccaacaaagaggaagcatct
aaaaaggtccatttgggcgatatggttacatttgatactacttattatgaggaaaatagc
tatgctgtagccaaagcctttgatgatagggttggatgttctattatgatggatataatt
gactatttttttgagaacaacgagaaacctctttacgatacatacttcaattttgctact
caggaagaaacggggttgagaggtacaggaactgcagcttcaaaaatacagccaaatttc
gctatcgtattagaaggtacaactgctggtgacaaccctgaaaacaccccggataaatgg
gcaacccatatcggaaatgggcccgtcttaacattcatgcatagcggtttagtactcaac
aaagaaatcttcgaaaaaattgtagatactgcaaagaaattaggtattaaatttcaatac
aaaatgcgaacagcaggaggaacaaacgccgccagactcgcaaagaccctttatggaatt
ccagcaggggtaatatccgttccatgccgatatattcattctccacaatctataatgaat
ttacaagattatgaaaatacctaccaattggtaaaacaattagtcgttaatacaccattt
taa

DBGET integrated database retrieval system