KEGG   Petrotoga mobilis: Pmob_1120Help
Entry
Pmob_1120         CDS       T00621                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pmo  Petrotoga mobilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pmob_1120
Enzymes [BR:pmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Pmob_1120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1201829..1202851
Genome map
AA seq 340 aa AA seqDB search
MRKYLKDLTNLAGISSREEKIREYIKSNVANKVDEITEDNMGNLICLIKGKDSSKKLMLD
AHMDEVGFMITRINEDGTFGISPVGGVDPRVVKSQRLKIEEKISAVVNSTPIHLEKETDK
VEQYESIKVYAGFSNKEEASKKVHLGDMVTFDTTYYEENSYAVAKAFDDRVGCSIMMDII
DYFFENNEKPLYDTYFNFATQEETGLRGTGTAASKIQPNFAIVLEGTTAGDNPENTPDKW
ATHIGNGPVLTFMHSGLVLNKEIFEKIVDTAKKLGIKFQYKMRTAGGTNAARLAKTLYGI
PAGVISVPCRYIHSPQSIMNLQDYENTYQLVKQLVVNTPF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagtatttaaaagacttaactaatcttgccggtatatcttcaagagaagaaaaa
ataagagagtacatcaaatcaaatgttgccaacaaggtcgatgaaattaccgaagacaac
atgggaaacctaatttgtttaattaaaggtaaagattcttccaaaaaattaatgcttgac
gcacacatggatgaagttggctttatgatcaccagaataaatgaagacggtacttttggc
atatctcccgttggaggagttgacccaagggtagtaaaaagtcagagattaaaaatcgaa
gaaaaaatatctgctgttgtcaattctacacccattcacttagaaaaagaaaccgacaaa
gttgaacagtatgaaagtataaaggtctacgctggattttccaacaaagaggaagcatct
aaaaaggtccatttgggcgatatggttacatttgatactacttattatgaggaaaatagc
tatgctgtagccaaagcctttgatgatagggttggatgttctattatgatggatataatt
gactatttttttgagaacaacgagaaacctctttacgatacatacttcaattttgctact
caggaagaaacggggttgagaggtacaggaactgcagcttcaaaaatacagccaaatttc
gctatcgtattagaaggtacaactgctggtgacaaccctgaaaacaccccggataaatgg
gcaacccatatcggaaatgggcccgtcttaacattcatgcatagcggtttagtactcaac
aaagaaatcttcgaaaaaattgtagatactgcaaagaaattaggtattaaatttcaatac
aaaatgcgaacagcaggaggaacaaacgccgccagactcgcaaagaccctttatggaatt
ccagcaggggtaatatccgttccatgccgatatattcattctccacaatctataatgaat
ttacaagattatgaaaatacctaccaattggtaaaacaattagtcgttaatacaccattt
taa

DBGET integrated database retrieval system